PDB entry 3m5b

View 3m5b on RCSB PDB site
Description: Crystal structure of the BTB domain from FAZF/ZBTB32
Class: transcription
Keywords: BTB domain, POZ domain, BTB/POZ domain, ZBTB32, Zinc finger and BTB domain-containing protein 32, Fanconi anemia zinc finger protein, FAXF, Rog, TZFP, ZNF538, Testis zinc finger protein, FANCC-interacting protein, transcription regulator, alpha/beta protein, PROTEIN-PROTEIN INTERACTION DOMAIN, ZINC-FINGER PROTEIN, DNA-binding, Metal-binding, Nucleus, Repressor, Transcription, Transcription regulation, Zinc-finger, DNA BINDING PROTEIN, FAZF
Deposited on 2010-03-12, released 2010-06-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2010-07-28, with a file datestamp of 2010-07-23.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.189
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Zinc finger and BTB domain-containing protein 32
    Species: Homo sapiens [TaxId:9606]
    Gene: FAZF, TZFP, ZBTB32
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3m5ba_
  • Chain 'B':
    Compound: Zinc finger and BTB domain-containing protein 32
    Species: Homo sapiens [TaxId:9606]
    Gene: FAZF, TZFP, ZBTB32
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3m5bb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3m5bA (A:)
gsmslppirlpspygsdrlvqlaarlrpalcdtlitvgsqefpahslvlagvsqqlgrrg
qwalgegispstfaqllnfvygesvelqpgelrplqeaaralgvqsleeacwrargdra

    Sequence, based on observed residues (ATOM records): (download) 
    >3m5bA (A:)
pirlpspygsdrlvqlaarlrpalcdtlitvgsqefpahslvlagvsqqlgrrgqwalge
gispstfaqllnfvygesvelqpgelrplqeaaralgvqsleeacwrar

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >3m5bB (B:)
gsmslppirlpspygsdrlvqlaarlrpalcdtlitvgsqefpahslvlagvsqqlgrrg
qwalgegispstfaqllnfvygesvelqpgelrplqeaaralgvqsleeacwrargdra

    Sequence, based on observed residues (ATOM records): (download) 
    >3m5bB (B:)
pirlpspygsdrlvqlaarlrpalcdtlitvgsqefpahslvlagvsqqlgrrgqwalge
gispstfaqllnfvygesvelqpgelrplqeaaralgvqsleeacwrar