PDB entry 3m4v

View 3m4v on RCSB PDB site
Description: Crystal structure of the A330P mutant of cytochrome P450 BM3
Class: oxidoreductase
Keywords: Cytochrome P450 fold, Electron transport, FAD, Flavoprotein, FMN, Heme, Iron, Metal-binding, Monooxygenase, Multifunctional enzyme, NADP, Oxidoreductase
Deposited on 2010-03-12, released 2011-03-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-12-18, with a file datestamp of 2013-12-13.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.189
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bifunctional P-450/NADPH-P450 reductase
    Species: Bacillus megaterium [TaxId:1404]
    Gene: P450BM-3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14779
      • engineered mutation (330)
    Domains in SCOPe 2.07: d3m4va_
  • Chain 'B':
    Compound: Bifunctional P-450/NADPH-P450 reductase
    Species: Bacillus megaterium [TaxId:1404]
    Gene: P450BM-3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14779
      • engineered mutation (330)
    Domains in SCOPe 2.07: d3m4vb_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3m4vA (A:)
    mtikempqpktfgelknlpllntdkpvqalmkiadelgeifkfeapgrvtrylssqrlik
    eacdesrfdknlsqalkfvrdfagdglftswtheknwkkahnillpsfsqqamkgyhamm
    vdiavqlvqkwerlnadehievpedmtrltldtiglcgfnyrfnsfyrdqphpfitsmvr
    aldeamnklqranpddpaydenkrqfqedikvmndlvdkiiadrkasgeqsddllthmln
    gkdpetgeplddeniryqiitfliaghettsgllsfalyflvknphvlqkaaeeaarvlv
    dpvpsykqvkqlkyvgmvlnealrlwptappfslyakedtvlggeyplekgdelmvlipq
    lhrdktiwgddveefrperfenpsaipqhafkpfgngqracigqqfalheatlvlgmmlk
    hfdfedhtnyeldiketltlkpegfvvkakskkiplggipspsteqsakkvrkkaenahn
    tp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3m4vA (A:)
    mpqpktfgelknlpllntdkpvqalmkiadelgeifkfeapgrvtrylssqrlikeacde
    srfdknlsqalkfvrdfagdglftswtheknwkkahnillpsfsqqamkgyhammvdiav
    qlvqkwerlnadehievpedmtrltldtiglcgfnyrfnsfyrdqphpfitsmvraldea
    mnklqranpddpaydenkrqfqedikvmndlvdkiiadrkasgeqsddllthmlngkdpe
    tgeplddeniryqiitfliaghettsgllsfalyflvknphvlqkaaeeaarvlvdpvps
    ykqvkqlkyvgmvlnealrlwptappfslyakedtvlggeyplekgdelmvlipqlhrdk
    tiwgddveefrperfenpsaipqhafkpfgngqracigqqfalheatlvlgmmlkhfdfe
    dhtnyeldiketltlkpegfvvkakskkipl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3m4vB (B:)
    mtikempqpktfgelknlpllntdkpvqalmkiadelgeifkfeapgrvtrylssqrlik
    eacdesrfdknlsqalkfvrdfagdglftswtheknwkkahnillpsfsqqamkgyhamm
    vdiavqlvqkwerlnadehievpedmtrltldtiglcgfnyrfnsfyrdqphpfitsmvr
    aldeamnklqranpddpaydenkrqfqedikvmndlvdkiiadrkasgeqsddllthmln
    gkdpetgeplddeniryqiitfliaghettsgllsfalyflvknphvlqkaaeeaarvlv
    dpvpsykqvkqlkyvgmvlnealrlwptappfslyakedtvlggeyplekgdelmvlipq
    lhrdktiwgddveefrperfenpsaipqhafkpfgngqracigqqfalheatlvlgmmlk
    hfdfedhtnyeldiketltlkpegfvvkakskkiplggipspsteqsakkvrkkaenahn
    tp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3m4vB (B:)
    mpqpktfgelknlpllntdkpvqalmkiadelgeifkfeapgrvtrylssqrlikeacde
    srfdknlsqalkfvrdfagdglftswtheknwkkahnillpsfsqqamkgyhammvdiav
    qlvqkwerlnadehievpedmtrltldtiglcgfnyrfnsfyrdqphpfitsmvraldea
    mnklkrqfqedikvmndlvdkiiadrkasgeqsddllthmlngkdpetgeplddeniryq
    iitfliaghettsgllsfalyflvknphvlqkaaeeaarvlvdpvpsykqvkqlkyvgmv
    lnealrlwptappfslyakedtvlggeyplekgdelmvlipqlhrdktiwgddveefrpe
    rfenpsaipqhafkpfgngqracigqqfalheatlvlgmmlkhfdfedhtnyeldiketl
    tlkpegfvvkakskkipl