PDB entry 3m4t

View 3m4t on RCSB PDB site
Description: Crystal structure of the BTB domain from Kaiso/ZBTB33, form I
Class: transcription
Keywords: Kaiso, ZBTB33, Transcriptional regulator Kaiso, Zinc finger and BTB domain-containing protein 33, ZNF348, Protein-protein interaction domain, oligomeriation, BTB domain, POZ domain, BTB/POZ domain, ZINC-FINGER PROTEIN, Activator, DNA-binding, Metal-binding, Nucleus, Phosphoprotein, Repressor, Transcription, Transcription regulation, Wnt signaling pathway, Zinc-finger
Deposited on 2010-03-11, released 2011-04-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-06-01, with a file datestamp of 2011-05-27.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.193
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcriptional regulator Kaiso
    Species: Homo sapiens [TaxId:9606]
    Gene: KAISO, ZBTB33, ZNF348
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3m4ta_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3m4tA (A:)
    gsmesrklisatdiqysgsllnslneqrghglfcdvtvivedrkfrahknilsasstyfh
    qlfsvagqvvelsfiraeifaeilnyiysskivrvrsdlldeliksgqllgvkfiaelgv
    plsq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3m4tA (A:)
    srklisatdiqysgsllnslneqrghglfcdvtvivedrkfrahknilsasstyfhqlfs
    vagqvvelsfiraeifaeilnyiysskivrvrsdlldeliksgqllgvkfiaelg