PDB entry 3m49

View 3m49 on RCSB PDB site
Description: Crystal Structure of Transketolase Complexed with Thiamine Diphosphate from Bacillus anthracis
Class: transferase
Keywords: alpha-beta-alpha sandwich, CSGID, Transferase, Structural Genomics, Center for Structural Genomics of Infectious Diseases
Deposited on 2010-03-10, released 2010-04-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transketolase
    Species: Bacillus anthracis [TaxId:261594]
    Gene: BAS3470, BA_3744, GBAA3744, GBAA_3744, tkt-2, tkt2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3m49a1, d3m49a2, d3m49a3
  • Chain 'B':
    Compound: transketolase
    Species: Bacillus anthracis [TaxId:261594]
    Gene: BAS3470, BA_3744, GBAA3744, GBAA_3744, tkt-2, tkt2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3m49b1, d3m49b2, d3m49b3
  • Heterogens: TDP, SO4, FMT, GOL, ACY, PG5, PEG, TRS, MG, BTB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3m49A (A:)
    mhhhhhhssgvdlgtenlyfqsnamshsieqlsintirtlsidaiekansghpgmpmgaa
    pmaytlwtqfmkhnpnnptwfnrdrfvlsaghgsmllysllhlsgydvtmddlknfrqwg
    sktpghpeyghtagvdattgplgqgiatavgmamaerhlaakynrdaynivdhytyaicg
    dgdlmegvsaeasslaahlqlgrlvvlydsndisldgdlnrsfsesvedrykaygwqvir
    vedgndieaiakaieeakadekrptlievrttigfgspnksgksashgsplgveetkltk
    eayawtaeqdfhvaeevyenfrktvqdvgetaqaewntmlgeyaqaypelanelqaamng
    llpegweqnlptyelgskaatrnssgavinaiaesvpsffggsadlagsnktymnnekdf
    trddysgkniwygvrefamgaamngialhgglktyggtffvfsdylrpairlaalmqlpv
    tyvfthdsiavgedgpthepieqlaalrampnvsvirpadgnesvaawrlalestnkpta
    lvltrqdlptlegakddtyekvakgayvvsaskketadvillatgsevslaveaqkalav
    dgvdasvvsmpsmdrfeaqtaeykesvlpkavtkrfaiemgatfgwhryvglegdvlgid
    tfgasapgekimeeygftvenvvrkvkeml
    

    Sequence, based on observed residues (ATOM records): (download)
    >3m49A (A:)
    shsieqlsintirtlsidaiekansghpgmpmgaapmaytlwtqfmkhnpnnptwfnrdr
    fvlsaghgsmllysllhlsgydvtmddlknfrqwgsktpghpeyghtagvdattgplgqg
    iatavgmamaerhlaakynrdaynivdhytyaicgdgdlmegvsaeasslaahlqlgrlv
    vlydsndisldgdlnrsfsesvedrykaygwqvirvedgndieaiakaieeakadekrpt
    lievrttigfgspnksgksashgsplgveetkltkeayawtaeqdfhvaeevyenfrktv
    qdvgetaqaewntmlgeyaqaypelanelqaamngllpegweqnlptyelgskaatrnss
    gavinaiaesvpsffggsadlagsnktymnnekdftrddysgkniwygvrefamgaamng
    ialhgglktyggtffvfsdylrpairlaalmqlpvtyvfthdsiavgedgpthepieqla
    alrampnvsvirpadgnesvaawrlalestnkptalvltrqdlptlegakddtyekvakg
    ayvvsaskketadvillatgsevslaveaqkalavdgvdasvvsmpsmdrfeaqtaeyke
    svlpkavtkrfaiemgatfgwhryvglegdvlgidtfgasapgekimeeygftvenvvrk
    vkeml
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3m49B (B:)
    mhhhhhhssgvdlgtenlyfqsnamshsieqlsintirtlsidaiekansghpgmpmgaa
    pmaytlwtqfmkhnpnnptwfnrdrfvlsaghgsmllysllhlsgydvtmddlknfrqwg
    sktpghpeyghtagvdattgplgqgiatavgmamaerhlaakynrdaynivdhytyaicg
    dgdlmegvsaeasslaahlqlgrlvvlydsndisldgdlnrsfsesvedrykaygwqvir
    vedgndieaiakaieeakadekrptlievrttigfgspnksgksashgsplgveetkltk
    eayawtaeqdfhvaeevyenfrktvqdvgetaqaewntmlgeyaqaypelanelqaamng
    llpegweqnlptyelgskaatrnssgavinaiaesvpsffggsadlagsnktymnnekdf
    trddysgkniwygvrefamgaamngialhgglktyggtffvfsdylrpairlaalmqlpv
    tyvfthdsiavgedgpthepieqlaalrampnvsvirpadgnesvaawrlalestnkpta
    lvltrqdlptlegakddtyekvakgayvvsaskketadvillatgsevslaveaqkalav
    dgvdasvvsmpsmdrfeaqtaeykesvlpkavtkrfaiemgatfgwhryvglegdvlgid
    tfgasapgekimeeygftvenvvrkvkeml
    

    Sequence, based on observed residues (ATOM records): (download)
    >3m49B (B:)
    hsieqlsintirtlsidaiekansghpgmpmgaapmaytlwtqfmkhnpnnptwfnrdrf
    vlsaghgsmllysllhlsgydvtmddlknfrqwgsktpghpeyghtagvdattgplgqgi
    atavgmamaerhlaakynrdaynivdhytyaicgdgdlmegvsaeasslaahlqlgrlvv
    lydsndisldgdlnrsfsesvedrykaygwqvirvedgndieaiakaieeakadekrptl
    ievrttigfgspnksgksashgsplgveetkltkeayawtaeqdfhvaeevyenfrktvq
    dvgetaqaewntmlgeyaqaypelanelqaamngllpegweqnlptyelgskaatrnssg
    avinaiaesvpsffggsadlagsnktymnnekdftrddysgkniwygvrefamgaamngi
    alhgglktyggtffvfsdylrpairlaalmqlpvtyvfthdsiavgedgpthepieqlaa
    lrampnvsvirpadgnesvaawrlalestnkptalvltrqdlptlegakddtyekvakga
    yvvsaskketadvillatgsevslaveaqkalavdgvdasvvsmpsmdrfeaqtaeykes
    vlpkavtkrfaiemgatfgwhryvglegdvlgidtfgasapgekimeeygftvenvvrkv
    keml