PDB entry 3m3d

View 3m3d on RCSB PDB site
Description: Crystal structure of Acetylcholinesterase in complex with Xenon
Class: hydrolase
Keywords: protein-Xe complex, Acetylcholinesterase, Alpha/Beta Hydrolase, Serine esterase, GLYCOSYLATED PROTEIN, Cell junction, Cell membrane, Disulfide bond, Glycoprotein, GPI-anchor, Hydrolase, Lipoprotein, Membrane, Neurotransmitter degradation, Synapse
Deposited on 2010-03-09, released 2011-03-09
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-03-09, with a file datestamp of 2011-03-04.
Experiment type: XRAY
Resolution: 2.34 Å
R-factor: 0.209
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acetylcholinesterase
    Species: Torpedo californica [TaxId:7787]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3m3da_
  • Heterogens: XE, NAG, PG4, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3m3dA (A:)
    ddhsellvntksgkvmgtrvpvlsshisaflgipfaeppvgnmrfrrpepkkpwsgvwna
    stypnncqqyvdeqfpgfsgsemwnpnremsedclylniwvpsprpksttvmvwiygggf
    ysgsstldvyngkylayteevvlvslsyrvgafgflalhgsqeapgnvglldqrmalqwv
    hdniqffggdpktvtifgesaggasvgmhilspgsrdlfrrailqsgspncpwasvsvae
    grrravelgrnlncnlnsdeelihclrekkpqelidvewnvlpfdsifrfsfvpvidgef
    fptslesmlnsgnfkktqillgvnkdegsffllygapgfskdseskisredfmsgvklsv
    phandlgldavtlqytdwmddnngiknrdglddivgdhnvicplmhfvnkytkfgngtyl
    yffnhrasnlvwpewmgvihgyeiefvfglplvkelnytaeeealsrrimhywatfaktg
    npnephsqeskwplfttkeqkfidlntepmkvhqrlrvqmcvfwnqflpkllnatacdge
    lss
    

    Sequence, based on observed residues (ATOM records): (download)
    >3m3dA (A:)
    sellvntksgkvmgtrvpvlsshisaflgipfaeppvgnmrfrrpepkkpwsgvwnasty
    pnncqqyvdeqfpgfsgsemwnpnremsedclylniwvpsprpksttvmvwiygggfysg
    sstldvyngkylayteevvlvslsyrvgafgflalhgsqeapgnvglldqrmalqwvhdn
    iqffggdpktvtifgesaggasvgmhilspgsrdlfrrailqsgspncpwasvsvaegrr
    ravelgrnlncnlnsdeelihclrekkpqelidvewnvlpfdsifrfsfvpvidgeffpt
    slesmlnsgnfkktqillgvnkdegsffllygapgfskdseskisredfmsgvklsvpha
    ndlgldavtlqytdwmddnngiknrdglddivgdhnvicplmhfvnkytkfgngtylyff
    nhrasnlvwpewmgvihgyeiefvfglplvkelnytaeeealsrrimhywatfaktgnpn
    ephsqeskwplfttkeqkfidlntepmkvhqrlrvqmcvfwnqflpkllnat