PDB entry 3m3c

View 3m3c on RCSB PDB site
Description: Crystal Structure of Agrocybe aegerita lectin AAL complexed with p-Nitrophenyl TF disaccharide
Class: hydrolase
Keywords: galectin, AAL, Thomsen-Friedenreich disaccharide, Apoptosis, Hydrolase, Lectin, Nuclease, Gal-BATA-1, 3-GalNAc-ALPHA-1-p-Nitrophenyl
Deposited on 2010-03-09, released 2010-12-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Anti-tumor lectin
    Species: Agrocybe aegerita [TaxId:5400]
    Gene: AAL
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6WY08 (1-158)
      • expression tag (0)
      • see remark 999 (132)
    Domains in SCOPe 2.08: d3m3ca1, d3m3ca2
  • Chain 'B':
    Compound: Anti-tumor lectin
    Species: Agrocybe aegerita [TaxId:5400]
    Gene: AAL
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6WY08 (1-158)
      • expression tag (0)
      • see remark 999 (132)
    Domains in SCOPe 2.08: d3m3cb1, d3m3cb2
  • Heterogens: NPO, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3m3cA (A:)
mqgvniynisagtsvdlaapvttgdivtffssalnlnagagnpnnttlnlfaengayllh
iafrlqenviifnsrqpdgpwlveqrvsdvanqfagidgkamvtvfdhgdkyqvvinekt
viqytkqisgltsslsynateetsifstvveavtytgla

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3m3cB (B:)
mqgvniynisagtsvdlaapvttgdivtffssalnlnagagnpnnttlnlfaengayllh
iafrlqenviifnsrqpdgpwlveqrvsdvanqfagidgkamvtvfdhgdkyqvvinekt
viqytkqisgltsslsynateetsifstvveavtytgla