PDB entry 3m2z

View 3m2z on RCSB PDB site
Description: Fragment tethered to Carbonic Anhydrase II H64C mutant
Class: lyase
Keywords: 10 Stranded Twisted Beta-Sheets, Lyase, Disease mutation, Metal-binding
Deposited on 2010-03-08, released 2011-07-06
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-06, with a file datestamp of 2011-07-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.184
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Carbonic anhydrase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: CA2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00918
      • engineered (68)
    Domains in SCOPe 2.03: d3m2za_
  • Heterogens: ZN, BFE, CO3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3m2zA (A:)
    gspefmshhwgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqat
    slrilnngcafnvefddsqdkavlkggpldgtyrliqfhfhwgsldgqgsehtvdkkkya
    aelhlvhwntkygdfgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktkgksadf
    tnfdprgllpesldywtypgslttppllecvtwivlkepisvsseqvlkfrklnfngege
    peelmvdnwrpaqplknrqikasfk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3m2zA (A:)
    hhwgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslrilnn
    gcafnvefddsqdkavlkggpldgtyrliqfhfhwgsldgqgsehtvdkkkyaaelhlvh
    wntkygdfgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktkgksadftnfdprg
    llpesldywtypgslttppllecvtwivlkepisvsseqvlkfrklnfngegepeelmvd
    nwrpaqplknrqikasf