PDB entry 3m2w

View 3m2w on RCSB PDB site
Description: Crystal structure of MAPKAK kinase 2 (MK2) complexed with a spiroazetidine-tetracyclic ATP site inhibitor
Class: transferase
Keywords: SMALL MOLECULE INHIBITOR, spiroazetidine-tetracycle, ATP-SITE KINASE INHIBITOR, NOVARTIS compound NVP-BXS169, ATP-binding, Kinase, Nucleotide-binding, Phosphoprotein, Serine/threonine-protein kinase, Transferase
Deposited on 2010-03-08, released 2010-07-28
The last revision prior to the SCOPe 2.04 freeze date was dated 2010-07-28, with a file datestamp of 2010-07-23.
Experiment type: XRAY
Resolution: 2.41 Å
R-factor: 0.187
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MAP kinase-activated protein kinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPKAPK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P49137 (2-298)
      • engineered (171)
    Domains in SCOPe 2.04: d3m2wa_
  • Heterogens: L8I, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3m2wA (A:)
    gphvksglqikknaiiddykvtsqvlglgingkvlqifnkrtqekfalkmlqdcpkarre
    velhwrasqcphivrivdvyenlyagrkcllivmecldggelfsriqdrgdqaftereas
    eimksigeaiqylhsiniahrdvkpenllytskrpnailkltdfgfakettgekydkscd
    mwslgvimyillcgyppfysnhglaispgmktrirmgqyefpnpewsevseevkmlirnl
    lkteptqrmtitefmnhpwimqstkvpqtplhtsrvlkedkerwedvkeemtsalatmr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3m2wA (A:)
    hvksglqikknaiiddykvtsqvlglgingkvlqifnkrtqekfalkmlqdcpkarreve
    lhwrasqcphivrivdvyenlyagrkcllivmecldggelfsriqdrgdqaftereasei
    mksigeaiqylhsiniahrdvkpenllytskrpnailkltdfgfakettgekydkscdmw
    slgvimyillcgyppfyspgmktrirmgqyefpnpewsevseevkmlirnllkteptqrm
    titefmnhpwimqstkvpqtplhtsrvlkedkerwedvkeemtsalatmr