PDB entry 3m1q

View 3m1q on RCSB PDB site
Description: Carbonic Anhydrase II mutant W5C-H64C with opened disulfide bond
Class: lyase
Keywords: 10 Stranded Twisted Beta-Sheets, Lyase, Disease mutation, Metal-binding
Deposited on 2010-03-05, released 2011-05-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.69 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Carbonic anhydrase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: CA2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00918 (Start-264)
      • engineered (9)
      • engineered (68)
    Domains in SCOPe 2.07: d3m1qa_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3m1qA (A:)
    gspefmshhcgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqat
    slrilnngcafnvefddsqdkavlkggpldgtyrliqfhfhwgsldgqgsehtvdkkkya
    aelhlvhwntkygdfgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktkgksadf
    tnfdprgllpesldywtypgslttppllecvtwivlkepisvsseqvlkfrklnfngege
    peelmvdnwrpaqplknrqikasfk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3m1qA (A:)
    hcgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslrilnng
    cafnvefddsqdkavlkggpldgtyrliqfhfhwgsldgqgsehtvdkkkyaaelhlvhw
    ntkygdfgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktkgksadftnfdprgl
    lpesldywtypgslttppllecvtwivlkepisvsseqvlkfrklnfngegepeelmvdn
    wrpaqplknrqikasfk