PDB entry 3m1i

View 3m1i on RCSB PDB site
Description: Crystal structure of yeast CRM1 (Xpo1p) in complex with yeast RanBP1 (Yrb1p) and yeast RanGTP (Gsp1pGTP)
Class: protein transport
Keywords: HEAT REPEAT, EXPORTIN, GTP-binding, Nucleotide-binding, Nucleus, Protein transport, Transport, GTPase activation
Deposited on 2010-03-05, released 2010-06-02
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-03-05, with a file datestamp of 2014-02-28.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.178
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GTP-binding nuclear protein GSP1/CNR1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: GSP1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32835
      • engineered mutation (70)
  • Chain 'B':
    Compound: Ran-specific GTPase-activating protein 1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: YRB1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3m1ib_
  • Chain 'C':
    Compound: Exportin-1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: XPO1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P30822 (2-End)
      • expression tag (0-1)
  • Heterogens: GTP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3m1iB (B:)
    dkkeeaapkppssavfsmfggkkaekpetkkdeedtkeetkkegddapespdihfepvvh
    lekvdvktmeedeevlykvraklfrfdadakewkergtgdckflknkktnkvrilmrrdk
    tlkicanhiiapeytlkpnvgsdrswvyactadiaegeaeaftfairfgskenadkfkee
    fekaqeinkka
    

    Sequence, based on observed residues (ATOM records): (download)
    >3m1iB (B:)
    lekvdvktmeedeevlykvraklfrfdadakewkergtgdckflknkktnkvrilmrrdk
    tlkicanhiiapeytlkpnvgsdrswvyactadiaegeaeaftfairfgskenadkfkee
    fekaqeinkka
    

  • Chain 'C':
    No sequence available.