PDB entry 3m0s

View 3m0s on RCSB PDB site
Description: Crystal Structure of the R21D mutant of alpha-spectrin SH3 domain. Crystal obtained in ammonium sulphate at pH 7
Class: signaling protein
Keywords: SH3-like barrel, Actin capping, Actin-binding, Calmodulin-binding, Cytoskeleton, Phosphoprotein, SH3 domain, SIGNALING PROTEIN
Deposited on 2010-03-03, released 2011-01-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-01-19, with a file datestamp of 2011-01-14.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.178
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Spectrin alpha chain, brain
  Species: Gallus gallus [TaxId:9031]
  Gene: SPTAN1, SPTA2
  Database cross-references and differences (RAF-indexed):
  • Uniprot P07751 (0-56)
    • engineered (15)
  Domains in SCOPe 2.06: d3m0sa_
• Heterogens: SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3m0sA (A:)
  kelvlalydyqekspdevtmkkgdiltllnstnkdwwkvevndrqgfvpaayvkkld