PDB entry 3m0g

View 3m0g on RCSB PDB site
Description: CRYSTAL STRUCTURE OF putative farnesyl diphosphate synthase from Rhodobacter capsulatus
Class: transferase
Keywords: STRUCTURAL GENOMICS, PROTEIN STRUCTURE INITIATIVE, NYSGXRC, Isoprene biosynthesis, Transferase, PSI-2, New York SGX Research Center for Structural Genomics
Deposited on 2010-03-03, released 2010-03-31
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.262
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Farnesyl Diphosphate Synthase
    Species: Rhodobacter capsulatus [TaxId:1061]
    Gene: 8272412
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KWR7 (3-End)
      • expression tag (1-2)
      • see remark 999 (12)
      • see remark 999 (15)
      • see remark 999 (60)
      • see remark 999 (99)
      • see remark 999 (103)
      • see remark 999 (192)
      • see remark 999 (198-199)
      • see remark 999 (201)
      • see remark 999 (249)
      • see remark 999 (253)
      • see remark 999 (274)
    Domains in SCOPe 2.06: d3m0ga1, d3m0ga2
  • Chain 'B':
    Compound: Farnesyl Diphosphate Synthase
    Species: Rhodobacter capsulatus [TaxId:1061]
    Gene: 8272412
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KWR7 (3-End)
      • expression tag (1-2)
      • see remark 999 (12)
      • see remark 999 (15)
      • see remark 999 (60)
      • see remark 999 (99)
      • see remark 999 (103)
      • see remark 999 (192)
      • see remark 999 (198-199)
      • see remark 999 (201)
      • see remark 999 (249)
      • see remark 999 (253)
      • see remark 999 (274)
    Domains in SCOPe 2.06: d3m0gb1, d3m0gb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3m0gA (A:)
    mslserlkevqdavetamaaaigrlpagdlrdamayaaqggkrlraflaiesaaihgism
    aqampaalavealhayslvhddmpcmdnddlrrglptvhkkwddatavlagdalqtlafe
    lctdpvlgsaenrvalvaalaqasgaegmvygqaldiaaetaavpltldeiirlqagktg
    alisfaaqagailagadrgpltayatalglafqiaddildvegneeaagkrlgkdaeahk
    atfvsllglagaksraadlvaeaeaalapygeaastlracaryvierdkeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3m0gA (A:)
    slserlkevqdavetamaaaigrlpagdlrdamayaaqggkrlraflaiesaaihgisma
    qampaalavealhayslvhddmpcmdnddlrrglptvhkkwddatavlagdalqtlafel
    ctdpvlgsaenrvalvaalaqasgaegmvygqaldiaaetaavpltldeiirlqagktga
    lisfaaqagailagadrgpltayatalglafqiaddilatfvsllglagaksraadlvae
    aeaalapygeaastlracaryvie
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3m0gB (B:)
    mslserlkevqdavetamaaaigrlpagdlrdamayaaqggkrlraflaiesaaihgism
    aqampaalavealhayslvhddmpcmdnddlrrglptvhkkwddatavlagdalqtlafe
    lctdpvlgsaenrvalvaalaqasgaegmvygqaldiaaetaavpltldeiirlqagktg
    alisfaaqagailagadrgpltayatalglafqiaddildvegneeaagkrlgkdaeahk
    atfvsllglagaksraadlvaeaeaalapygeaastlracaryvierdkeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3m0gB (B:)
    slserlkevqdavetamaaaigrlpagdlrdamayaaqggkrlraflaiesaaihgisma
    qampaalavealhayslvhddmpcmdnddlrrglptvhkkwddatavlagdalqtlafel
    ctdpvlgsaenrvalvaalaqasgaegmvygqaldiaaetaavpltldeiirlqagktga
    lisfaaqagailagadrgpltayatalglafqiaddildvkatfvsllglagaksraadl
    vaeaeaalapygeaastlracaryvier