PDB entry 3lye

View 3lye on RCSB PDB site
Description: Crystal structure of oxaloacetate acetylhydrolase
Class: hydrolase
Keywords: (alpha/beta)8 barrel, HYDROLASE
Deposited on 2010-02-26, released 2010-06-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-01-19, with a file datestamp of 2011-01-14.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.131
AEROSPACI score: 0.8 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Oxaloacetate acetyl hydrolase
    Species: CRYPHONECTRIA PARASITICA [TaxId:5116]
    Gene: OAH
    Database cross-references and differences (RAF-indexed):
    • PDB 3LYE
    Domains in SCOPe 2.07: d3lyea_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3lyeA (A:)
    gshmaedepfsgakklrhllentdelivcpgvydglsartamelgfkslymtgagttasr
    lgqpdlaiaqlhdmrdnadmianldpfgppliadmdtgyggpimvartvehyirsgvaga
    hledqiltkrcghlsgkkvvsrdeylvriraavatkrrlrsdfvliartdalqslgyeec
    ierlraardegadvgllegfrskeqaaaavaalapwplllnsvenghsplitveeakamg
    frimifsfatlapayaairetlvrlrdhgvvgtpdgitpvrlfevcglqdamevdngagg
    kafsegv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lyeA (A:)
    epfsgakklrhllentdelivcpgvydglsartamelgfkslymtgagttasrlgqpdla
    iaqlhdmrdnadmianldpfgppliadmdtgyggpimvartvehyirsgvagahledqil
    tkkvvsrdeylvriraavatkrrlrsdfvliartdalqslgyeecierlraardegadvg
    llegfrskeqaaaavaalapwplllnsvenghsplitveeakamgfrimifsfatlapay
    aairetlvrlrdhgvvgtpdgitpvrlfevcglqdamevdngagg