PDB entry 3ly6

View 3ly6 on RCSB PDB site
Description: Crystal structure of human transglutaminase 2 complex with adenosine 5' Triphosphate
Class: Transferase
Keywords: transglutaminase, Acyltransferase, Diabetes mellitus, Disease mutation, Metal-binding, Phosphoprotein, Transferase
Deposited on 2010-02-26, released 2010-08-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-08-18, with a file datestamp of 2010-08-13.
Experiment type: XRAY
Resolution: 3.14 Å
R-factor: 0.233
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein-glutamine gamma-glutamyltransferase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: TGM2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21980 (Start-686)
      • see remark 999 (223)
      • expression tag (687)
    Domains in SCOPe 2.07: d3ly6a1, d3ly6a2, d3ly6a3, d3ly6a4, d3ly6a5
  • Chain 'B':
    Compound: Protein-glutamine gamma-glutamyltransferase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: TGM2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21980 (Start-686)
      • see remark 999 (223)
      • expression tag (687)
    Domains in SCOPe 2.07: d3ly6b1, d3ly6b2, d3ly6b3, d3ly6b4, d3ly6b5
  • Chain 'C':
    Compound: Protein-glutamine gamma-glutamyltransferase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: TGM2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21980 (Start-686)
      • see remark 999 (223)
      • expression tag (687)
    Domains in SCOPe 2.07: d3ly6c1, d3ly6c2, d3ly6c3, d3ly6c4, d3ly6c5
  • Heterogens: ATP

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ly6A (A:)
    maeelvlercdleletngrdhhtadlcreklvvrrgqpfwltlhfegrnyeasvdsltfs
    vvtgpapsqeagtkarfplrdaveegdwtatvvdqqdctlslqlttpanapiglyrlsle
    astgyqgssfvlghfillfnawcpadavyldseeerqeyvltqqgfiyqgsakfiknipw
    nfgqfedgildiclilldvnpkflknagrdcsrrsspvyvgrvgsgmvncnddqgvllgr
    wdnnygdgvspmswigsvdilrrwknhgcqrvkygqcwvfaavactvlrclgiptrvvtn
    ynsahdqnsnllieyfrnefgeiqgdksemiwnfhcwveswmtrpdlqpgyegwqaldpt
    pqeksegtyccgpvpvraikegdlstkydapfvfaevnadvvdwiqqddgsvhksinrsl
    ivglkistksvgrderedithtykypegsseereaftranhlnklaekeetgmamrirvg
    qsmnmgsdfdvfahitnntaeeyvcrlllcartvsyngilgpecgtkyllnlnlepfsek
    svplcilyekyrdcltesnlikvrallvepvinsyllaerdlylenpeikirilgepkqk
    rklvaevslqnplpvalegctftvegaglteeqktveipdpveageevkvrmdllplhmg
    lhklvvnfesdklkavkgfrnviigpalehhhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ly6A (A:)
    elvlercdleletngrdhhtadlcreklvvrrgqpfwltlhfegrnyeasvdsltfsvvt
    gpapsqeagtkarfplrdavgdwtatvvdqqdctlslqlttpanapiglyrlsleastgy
    qgssfvlghfillfnawcpadavyldseeerqeyvltqqgfiyqgsakfiknipwnfgqf
    edgildiclilldvnpkflknagrdcsrrsspvyvgrvgsgmvncnddqgvllgrwdnny
    gdgvspmswigsvdilrrwknhgcqrvkygqcwvfaavactvlrclgiptrvvtnynsah
    dqnsnllieyfrnefgeiqgdksemiwnfhcwveswmtrpdlqpgyegwqaldptpqeks
    egtyccgpvpvraikegdlstkydapfvfaevnadvvdwiqqddgsvhksinrslivglk
    istksvgrderedithtykypegsseereaftranhlnklaekeetgmamrirvgqsmnm
    gsdfdvfahitnntaeeyvcrlllcartvsyngilgpecgtkyllnlnlepfseksvplc
    ilyekyrdcltesnlikvrallvepvinsyllaerdlylenpeikirilgepkqkrklva
    evslqnplpvalegctftvegaglteeqktveipdpveageevkvrmdllplhmglhklv
    vnfesdklkavkgfrnviigpal
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ly6B (B:)
    maeelvlercdleletngrdhhtadlcreklvvrrgqpfwltlhfegrnyeasvdsltfs
    vvtgpapsqeagtkarfplrdaveegdwtatvvdqqdctlslqlttpanapiglyrlsle
    astgyqgssfvlghfillfnawcpadavyldseeerqeyvltqqgfiyqgsakfiknipw
    nfgqfedgildiclilldvnpkflknagrdcsrrsspvyvgrvgsgmvncnddqgvllgr
    wdnnygdgvspmswigsvdilrrwknhgcqrvkygqcwvfaavactvlrclgiptrvvtn
    ynsahdqnsnllieyfrnefgeiqgdksemiwnfhcwveswmtrpdlqpgyegwqaldpt
    pqeksegtyccgpvpvraikegdlstkydapfvfaevnadvvdwiqqddgsvhksinrsl
    ivglkistksvgrderedithtykypegsseereaftranhlnklaekeetgmamrirvg
    qsmnmgsdfdvfahitnntaeeyvcrlllcartvsyngilgpecgtkyllnlnlepfsek
    svplcilyekyrdcltesnlikvrallvepvinsyllaerdlylenpeikirilgepkqk
    rklvaevslqnplpvalegctftvegaglteeqktveipdpveageevkvrmdllplhmg
    lhklvvnfesdklkavkgfrnviigpalehhhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ly6B (B:)
    elvlercdleletngrdhhtadlcreklvvrrgqpfwltlhfegrnyeasvdsltfsvvt
    gpapsqeagtkarfplrdavgdwtatvvdqqdctlslqlttpanapiglyrlsleastgy
    qgssfvlghfillfnawcpadavyldseeerqeyvltqqgfiyqgsakfiknipwnfgqf
    edgildiclilldvnpkflknagrdcsrrsspvyvgrvgsgmvncnddqgvllgrwdnny
    gdgvspmswigsvdilrrwknhgcqrvkygqcwvfaavactvlrclgiptrvvtnynsah
    dqnsnllieyfrnefgeiqgdksemiwnfhcwveswmtrpdlqpgyegwqaldptpqeks
    egtyccgpvpvraikegdlstkydapfvfaevnadvvdwiqqddgsvhksinrslivglk
    istksvgrderedithtykypegsseereaftranhlnklaekeetgmamrirvgqsmnm
    gsdfdvfahitnntaeeyvcrlllcartvsyngilgpecgtkyllnlnlepfseksvplc
    ilyekyrdcltesnlikvrallvepvinsyllaerdlylenpeikirilgepkqkrklva
    evslqnplpvalegctftvegaglteeqktveipdpveageevkvrmdllplhmglhklv
    vnfesdklkavkgfrnviigpal
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3ly6C (C:)
    maeelvlercdleletngrdhhtadlcreklvvrrgqpfwltlhfegrnyeasvdsltfs
    vvtgpapsqeagtkarfplrdaveegdwtatvvdqqdctlslqlttpanapiglyrlsle
    astgyqgssfvlghfillfnawcpadavyldseeerqeyvltqqgfiyqgsakfiknipw
    nfgqfedgildiclilldvnpkflknagrdcsrrsspvyvgrvgsgmvncnddqgvllgr
    wdnnygdgvspmswigsvdilrrwknhgcqrvkygqcwvfaavactvlrclgiptrvvtn
    ynsahdqnsnllieyfrnefgeiqgdksemiwnfhcwveswmtrpdlqpgyegwqaldpt
    pqeksegtyccgpvpvraikegdlstkydapfvfaevnadvvdwiqqddgsvhksinrsl
    ivglkistksvgrderedithtykypegsseereaftranhlnklaekeetgmamrirvg
    qsmnmgsdfdvfahitnntaeeyvcrlllcartvsyngilgpecgtkyllnlnlepfsek
    svplcilyekyrdcltesnlikvrallvepvinsyllaerdlylenpeikirilgepkqk
    rklvaevslqnplpvalegctftvegaglteeqktveipdpveageevkvrmdllplhmg
    lhklvvnfesdklkavkgfrnviigpalehhhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ly6C (C:)
    elvlercdleletngrdhhtadlcreklvvrrgqpfwltlhfegrnyeasvdsltfsvvt
    gpapsqeagtkarfplrdavgdwtatvvdqqdctlslqlttpanapiglyrlsleastgy
    qgssfvlghfillfnawcpadavyldseeerqeyvltqqgfiyqgsakfiknipwnfgqf
    edgildiclilldvnpkflknagrdcsrrsspvyvgrvgsgmvncnddqgvllgrwdnny
    gdgvspmswigsvdilrrwknhgcqrvkygqcwvfaavactvlrclgiptrvvtnynsah
    dqnsnllieyfrnefgeiqgdksemiwnfhcwveswmtrpdlqpgyegwqaldptpqeks
    egtyccgpvpvraikegdlstkydapfvfaevnadvvdwiqqddgsvhksinrslivglk
    istksvgrderedithtykypegsseereaftranhlnklaekeetgmamrirvgqsmnm
    gsdfdvfahitnntaeeyvcrlllcartvsyngilgpecgtkyllnlnlepfseksvplc
    ilyekyrdcltesnlikvrallvepvinsyllaerdlylenpeikirilgepkqkrklva
    evslqnplpvalegctftvegaglteeqktveipdpveageevkvrmdllplhmglhklv
    vnfesdklkavkgfrnviigpal