PDB entry 3lxr

View 3lxr on RCSB PDB site
Description: Shigella IpgB2 in complex with human RhoA and GDP (complex C)
Class: Signaling Protein/RHOA-BINDING PROTEIN
Keywords: IpgB2, RhoA, GTPase, GEF, GEF-GTPase-complex, WxxxE, TTSS effector protein, bacterial GEF, cytoskeleton dynamics, Signaling Protein-RHOA-BINDING PROTEIN complex
Deposited on 2010-02-25, released 2010-03-31
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.68 Å
R-factor: 0.172
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transforming protein rhoa
    Species: Homo sapiens [TaxId:9606]
    Gene: RhoA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3lxra_
  • Chain 'F':
    Compound: IpgB2
    Species: Shigella flexneri [TaxId:623]
    Gene: ipgB2
    Database cross-references and differences (RAF-indexed):
  • Heterogens: GDP, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3lxrA (A:)
gplgsaairkklvivgdgacgktcllivfskdqfpevyvptvfenyvadievdgkqvela
lwdtagqedydrlrplsypdtdvilmcfsidspdslenipekwtpevkhfcpnvpiilvg
nkkdlrndehtrrelakmkqepvkpeegrdmanrigafgymecsaktkdgvrevfematr
aalqa

    Sequence, based on observed residues (ATOM records): (download) 
    >3lxrA (A:)
aairkklvivgdgacgktcllivfskdqfpevyvptvfenyvadievdgkqvelalwdta
gqedydrlrplsypdtdvilmcfsidspdslenipekwtpevkhfcpnvpiilvgnkkdl
rndehtrrelakmkqepvkpeegrdmanrigafgymecsaktkdgvrevfematraalqa

  • Chain 'F':
    No sequence available.