PDB entry 3lxo

View 3lxo on RCSB PDB site
Description: The crystal structure of ribonuclease A in complex with thymidine-3'-monophosphate
Class: hydrolase
Keywords: ribonuclease A, RNA cleavage, nucleotides, enzyme catalysis, inhibitors, Disulfide bond, Endonuclease, Glycation, Glycoprotein, Hydrolase, Nuclease, Secreted
Deposited on 2010-02-25, released 2010-04-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-08-25, with a file datestamp of 2010-08-20.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.145
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribonuclease pancreatic
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3lxoa_
  • Heterogens: T3P, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3lxoA (A:)
    ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
    knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
    dasv