PDB entry 3lxf

View 3lxf on RCSB PDB site
Description: Crystal Structure of [2Fe-2S] Ferredoxin Arx from Novosphingobium aromaticivorans
Class: metal binding protein
Keywords: [2Fe-2S] Ferredoxin, Iron, Iron-sulfur, Metal-binding, METAL BINDING PROTEIN
Deposited on 2010-02-25, released 2010-06-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-02-12, with a file datestamp of 2014-02-07.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.202
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: ferredoxin
  Species: Novosphingobium aromaticivorans [TaxId:279238]
  Gene: Saro_1477
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q2G8A3 (0-103)
  Domains in SCOPe 2.08: d3lxfa_
• Chain 'B':
  Compound: ferredoxin
  Species: Novosphingobium aromaticivorans [TaxId:279238]
  Gene: Saro_1477
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q2G8A3 (0-103)
  Domains in SCOPe 2.08: d3lxfb_
• Chain 'C':
  Compound: ferredoxin
  Species: Novosphingobium aromaticivorans [TaxId:279238]
  Gene: Saro_1477
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q2G8A3 (0-103)
  Domains in SCOPe 2.08: d3lxfc_
• Chain 'D':
  Compound: ferredoxin
  Species: Novosphingobium aromaticivorans [TaxId:279238]
  Gene: Saro_1477
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q2G8A3 (0-103)
  Domains in SCOPe 2.08: d3lxfd_
• Chain 'E':
  Compound: ferredoxin
  Species: Novosphingobium aromaticivorans [TaxId:279238]
  Gene: Saro_1477
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q2G8A3 (0-103)
  Domains in SCOPe 2.08: d3lxfe_
• Heterogens: FES, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3lxfA (A:)
  tailvttrdgtrteiqaepglslmealrdagidellalcggccscatchvlvapafadrl
  palsgdendlldssdhrtphsrlscqitindklegleveiaped
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3lxfB (B:)
  tailvttrdgtrteiqaepglslmealrdagidellalcggccscatchvlvapafadrl
  palsgdendlldssdhrtphsrlscqitindklegleveiaped
  

  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3lxfC (C:)
  tailvttrdgtrteiqaepglslmealrdagidellalcggccscatchvlvapafadrl
  palsgdendlldssdhrtphsrlscqitindklegleveiaped
  

  
  
• Chain 'D':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3lxfD (D:)
  tailvttrdgtrteiqaepglslmealrdagidellalcggccscatchvlvapafadrl
  palsgdendlldssdhrtphsrlscqitindklegleveiaped
  

  
  
• Chain 'E':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3lxfE (E:)
  tailvttrdgtrteiqaepglslmealrdagidellalcggccscatchvlvapafadrl
  palsgdendlldssdhrtphsrlscqitindklegleveiaped