PDB entry 3lwn

View 3lwn on RCSB PDB site
Description: Shigella IpgB2 in complex with human RhoA, GDP and Mg2+ (complex B)
Class: Signaling Protein/RHOA-BINDING PROTEIN
Keywords: IpgB2, RhoA, GTPase, GEF, GEF-GTPase-complex, WxxxE, TTSS effector protein, bacterial GEF, cytoskeleton dynamics, Signaling Protein-RHOA-BINDING PROTEIN complex
Deposited on 2010-02-24, released 2010-03-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.28 Å
R-factor: 0.209
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transforming protein rhoa
    Species: Homo sapiens [TaxId:9606]
    Gene: RhoA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61586 (5-184)
      • expression tag (4)
    Domains in SCOPe 2.07: d3lwna1, d3lwna2
  • Chain 'B':
    Compound: transforming protein rhoa
    Species: Homo sapiens [TaxId:9606]
    Gene: RhoA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61586 (5-184)
      • expression tag (4)
    Domains in SCOPe 2.07: d3lwnb1, d3lwnb2
  • Chain 'F':
    Compound: IpgB2
    Species: Shigella flexneri [TaxId:623]
    Gene: ipgB2
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: IpgB2
    Species: Shigella flexneri [TaxId:623]
    Gene: ipgB2
    Database cross-references and differences (RAF-indexed):
  • Heterogens: GDP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3lwnA (A:)
    gplgsaairkklvivgdgacgktcllivfskdqfpevyvptvfenyvadievdgkqvela
    lwdtagqedydrlrplsypdtdvilmcfsidspdslenipekwtpevkhfcpnvpiilvg
    nkkdlrndehtrrelakmkqepvkpeegrdmanrigafgymecsaktkdgvrevfematr
    aalqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lwnA (A:)
    saairkklvivgdgacgktcllivfskdqfpevyvptvfenyvadievdgkqvelalwdt
    agqedydrlrplsypdtdvilmcfsidspdslenipekwtpevkhfcpnvpiilvgnkkd
    lrndehtrrelakmkqepvkpeegrdmanrigafgymecsaktkdgvrevfematraalq
    a
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3lwnB (B:)
    gplgsaairkklvivgdgacgktcllivfskdqfpevyvptvfenyvadievdgkqvela
    lwdtagqedydrlrplsypdtdvilmcfsidspdslenipekwtpevkhfcpnvpiilvg
    nkkdlrndehtrrelakmkqepvkpeegrdmanrigafgymecsaktkdgvrevfematr
    aalqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lwnB (B:)
    saairkklvivgdgacgktcllivfskdqfpevyvptvfenyvadievdgkqvelalwdt
    agqedydrlrplsypdtdvilmcfsidspdslenipekwtpevkhfcpnvpiilvgnkkd
    lrndehtrrelakmkqepvkpeegrdmanrigafgymecsaktkdgvrevfematraalq
    a
    

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.