PDB entry 3lwb

View 3lwb on RCSB PDB site
Description: Crystal Structure of apo D-alanine:D-alanine Ligase (Ddl) from Mycobacterium tuberculosis
Class: ligase
Keywords: D-alanine--D-alanine Ligase, Ddl, D-alanyl--D-alanine Ligase, Rv2981c, D-alanine, Structural Genomics, TB Structural Genomics Consortium, TBSGC, ATP-binding, Cell shape, Cell wall biogenesis, degradation, Ligase, Magnesium, Manganese, Metal-binding, Nucleotide-binding, Peptidoglycan synthesis
Deposited on 2010-02-23, released 2010-03-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-01-05, with a file datestamp of 2010-12-31.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.173
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: d-alanine--d-alanine ligase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: ddl, ddlA, MT3059, MTCY349.06, Rv2981c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3lwba1, d3lwba2
  • Chain 'B':
    Compound: d-alanine--d-alanine ligase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: ddl, ddlA, MT3059, MTCY349.06, Rv2981c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3lwbb1, d3lwbb2
  • Heterogens: NO3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3lwbA (A:)
    msandrrdrrvrvavvfggrsnehaiscvsagsilrnldsrrfdviavgitpagswvltd
    anpdaltitnrelpqvksgsgtelalpadprrggqlvslppgagevlesvdvvfpvlhgp
    ygedgtiqgllelagvpyvgagvlasavgmdkeftkkllaadglpvgayavlrpprstlh
    rqecerlglpvfvkparggssigvsrvsswdqlpaavararrhdpkviveaaisgrelec
    gvlempdgtleastlgeirvagvrgredsfydfatkylddaaeldvpakvddqvaeairq
    lairafaaidcrglarvdffltddgpvineintmpgfttismyprmwaasgvdyptllat
    miettlargvglh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lwbA (A:)
    rdrrvrvavvfggaiscvsagsilrnldsrrfdviavgitpagswvltdanvslppgage
    vlesvdvvfpvlhgpygedgtiqgllelagvpyvgagvlasavgmdkeftkkllaadglp
    vgayavlrpprstlhrqecerlglpvfvkparggssigvsrvsswdqlpaavararrhdp
    kviveaaisgrelecgvlempdgtleastlgeirvagvrgredsfydfatkylddaaeld
    vpakvddqvaeairqlairafaaidcrglarvdffltddgpvineintmpgfttismypr
    mwaasgvdyptllatmiettlar
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3lwbB (B:)
    msandrrdrrvrvavvfggrsnehaiscvsagsilrnldsrrfdviavgitpagswvltd
    anpdaltitnrelpqvksgsgtelalpadprrggqlvslppgagevlesvdvvfpvlhgp
    ygedgtiqgllelagvpyvgagvlasavgmdkeftkkllaadglpvgayavlrpprstlh
    rqecerlglpvfvkparggssigvsrvsswdqlpaavararrhdpkviveaaisgrelec
    gvlempdgtleastlgeirvagvrgredsfydfatkylddaaeldvpakvddqvaeairq
    lairafaaidcrglarvdffltddgpvineintmpgfttismyprmwaasgvdyptllat
    miettlargvglh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lwbB (B:)
    rvrvavvfhaiscvsagsilrnldsrrfdviavgitpvlesvdvvfpvlhtiqgllelag
    vpyvgagvlasavgmdkeftkkllaadglpvgayavlrpprstlhrqecerlglpvfvkp
    arggssigvsrvsswdqlpaavararrhdpkviveaaisgrelecgvlempdgtleastl
    geirvagvrgredsfydfatkylddaaeldvpakvddqvaeairqlairafaaidcrgla
    rvdffltddgpvineintmpgfttismyprmwaasgvdyptllatmiettlargvglh