PDB entry 3lw1

View 3lw1 on RCSB PDB site
Description: Binary complex of 14-3-3 sigma and p53 pT387-peptide
Class: peptide binding protein
Keywords: adapter protein, Cytoplasm, Nucleus, Phosphoprotein, PEPTIDE BINDING PROTEIN
Deposited on 2010-02-23, released 2010-03-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-04-21, with a file datestamp of 2010-04-16.
Experiment type: XRAY
Resolution: 1.28 Å
R-factor: 0.128
AEROSPACI score: 0.83 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 14-3-3 protein sigma
    Species: Homo sapiens [TaxId:9606]
    Gene: HME1, SFN
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31947 (5-End)
      • expression tag (0-4)
    Domains in SCOPe 2.07: d3lw1a1, d3lw1a2
  • Chain 'P':
    Compound: peptide of Cellular tumor antigen p53
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: MG, CL, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3lw1A (A:)
    gamgsmerasliqkaklaeqaeryedmaafmkgavekgeelsceernllsvayknvvggq
    raawrvlssieqksneegseekgpevreyrekvetelqgvcdtvlglldshlikeagdae
    srvfylkmkgdyyrylaevatgddkkriidsarsayqeamdiskkempptnpirlglaln
    fsvfhyeianspeeaislakttfdeamadlhtlsedsykdstlimqllrdnltlwtadna
    geeggeapqepqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lw1A (A:)
    gamgsmerasliqkaklaeqaeryedmaafmkgavekgeelsceernllsvayknvvggq
    raawrvlssieqksneegseekgpevreyrekvetelqgvcdtvlglldshlikeagdae
    srvfylkmkgdyyrylaevatgdkkriidsarsayqeamdiskkempptnpirlglalnf
    svfhyeianspeeaislakttfdeamadlhtlsedsykdstlimqllrdnltlwt
    

  • Chain 'P':
    No sequence available.