PDB entry 3lvs

View 3lvs on RCSB PDB site
Description: Crystal structure of farnesyl diphosphate synthase from rhodobacter capsulatus sb1003
Class: transferase
Keywords: ISOPRENYL DIPHOSPHATE SYNTHASE, STRUCTURAL GENOMICS, PSI, PROTEIN STRUCTURE INITIATIVE, NYSGRC, NEW YORK STRUCTURAL GENOMIX RESEARCH CONSORTIUM, NYSGXRC, TRANSFERASE, New York SGX Research Center for Structural Genomics
Deposited on 2010-02-22, released 2010-03-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-04-10, with a file datestamp of 2013-04-05.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.218
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Farnesyl Diphosphate Synthase
    Species: Rhodobacter capsulatus [TaxId:1061]
    Gene: Trans_IPPS_HT
    Database cross-references and differences (RAF-indexed):
    • PDB 3LVS
    Domains in SCOPe 2.07: d3lvsa_
  • Chain 'B':
    Compound: Farnesyl Diphosphate Synthase
    Species: Rhodobacter capsulatus [TaxId:1061]
    Gene: Trans_IPPS_HT
    Database cross-references and differences (RAF-indexed):
    • PDB 3LVS
    Domains in SCOPe 2.07: d3lvsb_
  • Heterogens: PO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3lvsA (A:)
    mslfserlkeiqdavetamaaaigrlpagdlrdamayaaqggkrlraflaiesaaihgis
    maqampaalavealhayslvhddmpcmdnddlrrglptvhkkwddatavlagdalqtlaf
    elctdpvlgsaenrvalvaalaqasgaegmvygqaldiaaetaavpltldeiirlqagkt
    galisfaaqagailagadrgpltayatalglafqiaddildvegneeaagkrlgkdaeah
    katfvsllglagaksraadlvaeaeaalapygeaastlracaryvierdkeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lvsA (A:)
    slfserlkeiqdavetamaaaigrlpagdlrdamayaaqggkrlraflaiesaaihgism
    aqampaalavealhayslvhddmpcmdnddlrrglptvhkkwddatavlagdalqtlafe
    lctdpvlgsaenrvalvaalaqasgaegmvygqaldiaaetaavpltldeiirlqagktg
    alisfaaqagailagadrgpltayatalglafqiaddildveatfvsllglagaksraad
    lvaeaeaalapygeaastlracaryvierd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3lvsB (B:)
    mslfserlkeiqdavetamaaaigrlpagdlrdamayaaqggkrlraflaiesaaihgis
    maqampaalavealhayslvhddmpcmdnddlrrglptvhkkwddatavlagdalqtlaf
    elctdpvlgsaenrvalvaalaqasgaegmvygqaldiaaetaavpltldeiirlqagkt
    galisfaaqagailagadrgpltayatalglafqiaddildvegneeaagkrlgkdaeah
    katfvsllglagaksraadlvaeaeaalapygeaastlracaryvierdkeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lvsB (B:)
    slfserlkeiqdavetamaaaigrlpagdlrdamayaaqggkrlraflaiesaaihgism
    aqampaalavealhayslvhddmpcmdnddlrrglptvhkkwddatavlagdalqtlafe
    lctdpvlgsaenrvalvaalaqasgaegmvygqaldiaaetaavpltldeiirlqagktg
    alisfaaqagailagadrgpltayatalglafqiaddildvedaeahkatfvsllglaga
    ksraadlvaeaeaalapygeaastlracaryvie