PDB entry 3lve

View 3lve on RCSB PDB site
Description: len q38e mutant: a domain flip from a single amino acid substitution
Class: immunoglobulin
Keywords: immunoglobulin, kappa-IV, light chain dimer
Deposited on 1998-05-12, released 1999-05-18
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.176
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: len
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01625 (0-113)
      • engineered (43)
    Domains in SCOPe 2.02: d3lvea_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3lveA (A:)
    divmtqspdslavslgeratinckssqsvlyssnsknylawyqekpgqppklliywastr
    esgvpdrfsgsgsgtdftltisslqaedvavyycqqyystpysfgqgtkleikr