PDB entry 3lve

View 3lve on RCSB PDB site
Description: len q38e mutant: a domain flip from a single amino acid substitution
Deposited on 1998-05-12, released 1999-05-18
The last revision prior to the SCOP 1.55 freeze date was dated 1999-05-18, with a file datestamp of 1999-05-17.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.176
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d3lve__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3lve_ (-)
    divmtqspdslavslgeratinckssqsvlyssnsknylawyqekpgqppklliywastr
    esgvpdrfsgsgsgtdftltisslqaedvavyycqqyystpysfgqgtkleikr