PDB entry 3lus

View 3lus on RCSB PDB site
Description: Crystal structure of a putative organic hydroperoxide resistance protein with molecule of captopril bound in one of the active sites from Vibrio cholerae O1 biovar eltor str. N16961
Class: oxidoreductase
Keywords: ORGANIC HYDROPEROXIDE RESISTANCE PROTEIN, ORHC, CAPTOPRIL-BOUND, CSGID, NIAID, OXIDOREDUCTASE, Structural Genomics, Center for Structural Genomics of Infectious Diseases
Deposited on 2010-02-18, released 2010-04-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-05-01, with a file datestamp of 2013-04-26.
Experiment type: XRAY
Resolution: 1.96 Å
R-factor: 0.173
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: organic hydroperoxide resistance protein
    Species: Vibrio cholerae O1 biovar El Tor [TaxId:243277]
    Gene: VC_A1006
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3lusa_
  • Chain 'B':
    Compound: organic hydroperoxide resistance protein
    Species: Vibrio cholerae O1 biovar El Tor [TaxId:243277]
    Gene: VC_A1006
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KKU4 (3-147)
      • expression tag (0-2)
    Domains in SCOPe 2.06: d3lusb1, d3lusb2
  • Heterogens: X8Z, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3lusA (A:)
snamrnknmstiyqtsatasagrngvvstedkllelnlsypkemggsgtatnpeqlfavg
yaacfsnailhvareakvalkeapvtatvgigpngqggfalsvalaahialedeqarqlv
tvahqvcpysnavrgnidvqvsvnglal

    Sequence, based on observed residues (ATOM records): (download) 
    >3lusA (A:)
rnknmstiyqtsatasagrngvvstedkllelnlsypkemggsgtatnpeqlfavgyaac
fsnailhvareakvalkeapvtatvgigpngqggfalsvalaahialedeqarqlvtvah
qvcpysnavrgnidvqvsvnglal

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3lusB (B:)
snamrnknmstiyqtsatasagrngvvstedkllelnlsypkemggsgtatnpeqlfavg
yaacfsnailhvareakvalkeapvtatvgigpngqggfalsvalaahialedeqarqlv
tvahqvcpysnavrgnidvqvsvnglal