PDB entry 3ltx

View 3ltx on RCSB PDB site
Description: Crystal Structure of the Pacific Oyster Estrogen Receptor Ligand Binding Domain
Class: hormone receptor
Keywords: Estrogen Receptor, Estrogen, Constitutive, Nuclear Receptor, Steroid Receptor, DNA-binding, Metal-binding, Nucleus, Receptor, Transcription, Transcription regulation, Zinc-finger, HORMONE RECEPTOR
Deposited on 2010-02-16, released 2011-03-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-02-12, with a file datestamp of 2014-02-07.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.211
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Estrogen receptor
    Species: Crassostrea gigas [TaxId:29159]
    Gene: ER
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ltxa_
  • Chain 'B':
    Compound: Estrogen receptor
    Species: Crassostrea gigas [TaxId:29159]
    Gene: ER
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ltxb_
  • Chain 'C':
    Compound: Estrogen receptor
    Species: Crassostrea gigas [TaxId:29159]
    Gene: ER
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ltxc_
  • Chain 'D':
    Compound: Estrogen receptor
    Species: Crassostrea gigas [TaxId:29159]
    Gene: ER
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ltxd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ltxA (A:)
    snaksqtvtilqalnkaalpvleshhnhgqpptkvhllnslvklaerelvhlinwaknvp
    gytdlslsdqvhlieccwmellllncafrsiehggkslafapdlvldrsswstvemteif
    eqvaavseqmmqnhlhkdellllqamvlvnaevrrlasynqifnmqqslldaivdtaqky
    hpdnvrhvpavllllthirqagergiaffqrlksegvvtfcdllkemldaqdflekkssn
    egd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ltxA (A:)
    qtvtilqalnkaalpvleshhnhgqpptkvhllnslvklaerelvhlinwaknvpgytdl
    slsdqvhlieccwmellllncafrsiehggkslafapdlvldrsswstvemteifeqvaa
    vseqmmqnhlhkdellllqamvlvnaevrrlasynqifnmqqslldaivdtaqkyhpdnv
    rhvpavllllthirqagergiaffqrlksegvvtfcdllkemldaq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ltxB (B:)
    snaksqtvtilqalnkaalpvleshhnhgqpptkvhllnslvklaerelvhlinwaknvp
    gytdlslsdqvhlieccwmellllncafrsiehggkslafapdlvldrsswstvemteif
    eqvaavseqmmqnhlhkdellllqamvlvnaevrrlasynqifnmqqslldaivdtaqky
    hpdnvrhvpavllllthirqagergiaffqrlksegvvtfcdllkemldaqdflekkssn
    egd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ltxB (B:)
    qtvtilqalnkaalpvleshhnhgqpptkvhllnslvklaerelvhlinwaknvpgytdl
    slsdqvhlieccwmellllncafrsiehggkslafapdlvldrsswstvemteifeqvaa
    vseqmmqnhlhkdellllqamvlvnaevrrlasynqifnmqqslldaivdtaqkyhpdnv
    rhvpavllllthirqagergiaffqrlksegvvtfcdllkemldaqd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3ltxC (C:)
    snaksqtvtilqalnkaalpvleshhnhgqpptkvhllnslvklaerelvhlinwaknvp
    gytdlslsdqvhlieccwmellllncafrsiehggkslafapdlvldrsswstvemteif
    eqvaavseqmmqnhlhkdellllqamvlvnaevrrlasynqifnmqqslldaivdtaqky
    hpdnvrhvpavllllthirqagergiaffqrlksegvvtfcdllkemldaqdflekkssn
    egd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ltxC (C:)
    tvtilqalnkaalpvleshhnhgqpptkvhllnslvklaerelvhlinwaknvpgytdls
    lsdqvhlieccwmellllncafrsiehggkslafapdlvldrsswstvemteifeqvaav
    seqmmqnhlhkdellllqamvlvnaevrrlasynqifnmqqslldaivdtaqkyhpdnvr
    hvpavllllthirqagergiaffqrlksegvvtfcdllkemlda
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3ltxD (D:)
    snaksqtvtilqalnkaalpvleshhnhgqpptkvhllnslvklaerelvhlinwaknvp
    gytdlslsdqvhlieccwmellllncafrsiehggkslafapdlvldrsswstvemteif
    eqvaavseqmmqnhlhkdellllqamvlvnaevrrlasynqifnmqqslldaivdtaqky
    hpdnvrhvpavllllthirqagergiaffqrlksegvvtfcdllkemldaqdflekkssn
    egd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ltxD (D:)
    qtvtilqalnkaalpvleshhnhgqpptkvhllnslvklaerelvhlinwaknvpgytdl
    slsdqvhlieccwmellllncafrsiehggkslafapdlvldrsswstvemteifeqvaa
    vseqmmqnhlhkdellllqamvlvnaevrrlasynqifnmqqslldaivdtaqkyhpdnv
    rhvpavllllthirqagergiaffqrlksegvvtfcdllkemldaq