PDB entry 3ltv

View 3ltv on RCSB PDB site
Description: Mouse-human sod1 chimera
Class: oxidoreductase
Keywords: oxidoreductase, antioxidant, metal-binding, amyotrophic lateral sclerosis, disease mutation, phosphoprotein
Deposited on 2010-02-16, released 2010-09-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-06-07, with a file datestamp of 2017-06-02.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Superoxide dismutase [Cu-Zn],Superoxide dismutase [Cu-Zn]
    Species: Homo sapiens [TaxId:9606]
    Gene: SOD1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ltva_
  • Chain 'B':
    Compound: Superoxide dismutase [Cu-Zn],Superoxide dismutase [Cu-Zn]
    Species: Homo sapiens [TaxId:9606]
    Gene: SOD1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ltvb_
  • Chain 'C':
    Compound: Superoxide dismutase [Cu-Zn],Superoxide dismutase [Cu-Zn]
    Species: Homo sapiens [TaxId:9606]
    Gene: SOD1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ltvc_
  • Chain 'D':
    Compound: Superoxide dismutase [Cu-Zn],Superoxide dismutase [Cu-Zn]
    Species: Homo sapiens [TaxId:9606]
    Gene: SOD1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ltvd_
  • Chain 'E':
    Compound: Superoxide dismutase [Cu-Zn],Superoxide dismutase [Cu-Zn]
    Species: Homo sapiens [TaxId:9606]
    Gene: SOD1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ltve_
  • Chain 'F':
    Compound: Superoxide dismutase [Cu-Zn],Superoxide dismutase [Cu-Zn]
    Species: Homo sapiens [TaxId:9606]
    Gene: SOD1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ltvf_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ltvA (A:)
    amkavcvlkgdgpvqgtihfeqkasgepvvlsgqitgltegqhgfhvhqygdntqgctsa
    gphfnphskkhggpadeerhvgdlgnvtadkdgvadvsiedsvislsgdhciigrtlvvh
    ekaddlgkggneestktgnagsrlacgvigiaq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ltvB (B:)
    amkavcvlkgdgpvqgtihfeqkasgepvvlsgqitgltegqhgfhvhqygdntqgctsa
    gphfnphskkhggpadeerhvgdlgnvtadkdgvadvsiedsvislsgdhciigrtlvvh
    ekaddlgkggneestktgnagsrlacgvigiaq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3ltvC (C:)
    amkavcvlkgdgpvqgtihfeqkasgepvvlsgqitgltegqhgfhvhqygdntqgctsa
    gphfnphskkhggpadeerhvgdlgnvtadkdgvadvsiedsvislsgdhciigrtlvvh
    ekaddlgkggneestktgnagsrlacgvigiaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ltvC (C:)
    amkavcvlkgdgpvqgtihfeqkasgepvvlsgqitgltegqhgfhvhqygdntqgctsa
    gphfnphskkhggpadeerhvgdlgnvtadkdgvadvsiedsvislsgdhciigrtlvvh
    ekaddlgneestktgnagsrlacgvigiaq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3ltvD (D:)
    amkavcvlkgdgpvqgtihfeqkasgepvvlsgqitgltegqhgfhvhqygdntqgctsa
    gphfnphskkhggpadeerhvgdlgnvtadkdgvadvsiedsvislsgdhciigrtlvvh
    ekaddlgkggneestktgnagsrlacgvigiaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ltvD (D:)
    amkavcvlkgdgpvqgtihfeqkasgepvvlsgqitgltegqhgfhvhqygdntqgctsa
    gphfnphskkhggpadeerhvgdlgnvtadkdgvadvsiedsvislsgdhciigrtlvvh
    ekaddlgkggneestktgnagsrlacgvigia
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ltvE (E:)
    amkavcvlkgdgpvqgtihfeqkasgepvvlsgqitgltegqhgfhvhqygdntqgctsa
    gphfnphskkhggpadeerhvgdlgnvtadkdgvadvsiedsvislsgdhciigrtlvvh
    ekaddlgkggneestktgnagsrlacgvigiaq
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ltvF (F:)
    amkavcvlkgdgpvqgtihfeqkasgepvvlsgqitgltegqhgfhvhqygdntqgctsa
    gphfnphskkhggpadeerhvgdlgnvtadkdgvadvsiedsvislsgdhciigrtlvvh
    ekaddlgkggneestktgnagsrlacgvigiaq