PDB entry 3lte

View 3lte on RCSB PDB site
Description: CRYSTAL STRUCTURE OF RESPONSE REGULATOR (SIGNAL RECEIVER DOMAIN) FROM Bermanella marisrubri
Class: transcription
Keywords: STRUCTURAL GENOMICS, PSI, PROTEIN STRUCTURE INITIATIVE, NYSGRC, NEW YORK STRUCTURAL GENOMIX RESEARCH CONSORTIUM, NYSGXRC, New York SGX Research Center for Structural Genomics, TRANSCRIPTION
Deposited on 2010-02-15, released 2010-03-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.24
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Response regulator
    Species: Bermanella marisrubri [TaxId:207949]
    Gene: RED65_02614
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ltea_
  • Chain 'B':
    Compound: Response regulator
    Species: Bermanella marisrubri [TaxId:207949]
    Gene: RED65_02614
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3lteb_
  • Chain 'C':
    Compound: Response regulator
    Species: Bermanella marisrubri [TaxId:207949]
    Gene: RED65_02614
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ltec_
  • Chain 'D':
    Compound: Response regulator
    Species: Bermanella marisrubri [TaxId:207949]
    Gene: RED65_02614
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q1N036 (2-123)
      • expression tag (1)
    Domains in SCOPe 2.07: d3lted1, d3lted2
  • Chain 'E':
    Compound: Response regulator
    Species: Bermanella marisrubri [TaxId:207949]
    Gene: RED65_02614
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q1N036 (2-123)
      • expression tag (1)
    Domains in SCOPe 2.07: d3ltee1, d3ltee2
  • Chain 'F':
    Compound: Response regulator
    Species: Bermanella marisrubri [TaxId:207949]
    Gene: RED65_02614
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q1N036 (2-123)
      • expression tag (1)
    Domains in SCOPe 2.07: d3ltef1, d3ltef2
  • Chain 'G':
    Compound: Response regulator
    Species: Bermanella marisrubri [TaxId:207949]
    Gene: RED65_02614
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q1N036 (Start-123)
      • expression tag (124)
    Domains in SCOPe 2.07: d3lteg1, d3lteg2
  • Chain 'H':
    Compound: Response regulator
    Species: Bermanella marisrubri [TaxId:207949]
    Gene: RED65_02614
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q1N036 (2-123)
      • expression tag (1)
    Domains in SCOPe 2.07: d3lteh1, d3lteh2
  • Chain 'I':
    Compound: Response regulator
    Species: Bermanella marisrubri [TaxId:207949]
    Gene: RED65_02614
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q1N036 (Start-123)
      • expression tag (124)
    Domains in SCOPe 2.07: d3ltei1, d3ltei2
  • Chain 'J':
    Compound: Response regulator
    Species: Bermanella marisrubri [TaxId:207949]
    Gene: RED65_02614
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ltej_
  • Chain 'K':
    Compound: Response regulator
    Species: Bermanella marisrubri [TaxId:207949]
    Gene: RED65_02614
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ltek_
  • Chain 'L':
    Compound: Response regulator
    Species: Bermanella marisrubri [TaxId:207949]
    Gene: RED65_02614
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ltel_
  • Chain 'M':
    Compound: Response regulator
    Species: Bermanella marisrubri [TaxId:207949]
    Gene: RED65_02614
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ltem_
  • Chain 'N':
    Compound: Response regulator
    Species: Bermanella marisrubri [TaxId:207949]
    Gene: RED65_02614
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3lten_
  • Chain 'O':
    Compound: Response regulator
    Species: Bermanella marisrubri [TaxId:207949]
    Gene: RED65_02614
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3lteo_
  • Chain 'P':
    Compound: Response regulator
    Species: Bermanella marisrubri [TaxId:207949]
    Gene: RED65_02614
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q1N036 (2-123)
      • expression tag (1)
    Domains in SCOPe 2.07: d3ltep1, d3ltep2
  • Chain 'Q':
    Compound: Response regulator
    Species: Bermanella marisrubri [TaxId:207949]
    Gene: RED65_02614
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3lteq_
  • Chain 'R':
    Compound: Response regulator
    Species: Bermanella marisrubri [TaxId:207949]
    Gene: RED65_02614
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3lter_
  • Chain 'S':
    Compound: Response regulator
    Species: Bermanella marisrubri [TaxId:207949]
    Gene: RED65_02614
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ltes_
  • Chain 'T':
    Compound: Response regulator
    Species: Bermanella marisrubri [TaxId:207949]
    Gene: RED65_02614
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ltet_
  • Chain 'U':
    Compound: Response regulator
    Species: Bermanella marisrubri [TaxId:207949]
    Gene: RED65_02614
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3lteu_
  • Chain 'V':
    Compound: Response regulator
    Species: Bermanella marisrubri [TaxId:207949]
    Gene: RED65_02614
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ltev_
  • Chain 'W':
    Compound: Response regulator
    Species: Bermanella marisrubri [TaxId:207949]
    Gene: RED65_02614
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ltew_
  • Chain 'X':
    Compound: Response regulator
    Species: Bermanella marisrubri [TaxId:207949]
    Gene: RED65_02614
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ltex_
  • Heterogens: PO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3lteA (A:)
    mslkqskrilvvdddqamaaaiervlkrdhwqveiahngfdagiklstfepaimtldlsm
    pkldgldvirslrqnkvanqpkilvvsgldkaklqqavtegaddylekpfdndalldrih
    dlvneghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lteA (A:)
    krilvvdddqamaaaiervlkrdhwqveiahngfdagiklstfepaimtldlsmpkldgl
    dvirslrqnkvanqpkilvvsgldkaklqqavtegaddylekpfdndalldrihdlvn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3lteB (B:)
    mslkqskrilvvdddqamaaaiervlkrdhwqveiahngfdagiklstfepaimtldlsm
    pkldgldvirslrqnkvanqpkilvvsgldkaklqqavtegaddylekpfdndalldrih
    dlvneghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lteB (B:)
    qskrilvvdddqamaaaiervlkrdhwqveiahngfdagiklstfepaimtldlsmpkld
    gldvirslrqnkvanqpkilvvsgldkaklqqavtegaddylekpfdndalldrihdlvn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3lteC (C:)
    mslkqskrilvvdddqamaaaiervlkrdhwqveiahngfdagiklstfepaimtldlsm
    pkldgldvirslrqnkvanqpkilvvsgldkaklqqavtegaddylekpfdndalldrih
    dlvneghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lteC (C:)
    skrilvvdddqamaaaiervlkrdhwqveiahngfdagiklstfepaimtldlsmpkldg
    ldvirslrqnkvanqpkilvvsgldkaklqqavtegaddylekpfdndalldrihdlvn
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3lteD (D:)
    mslkqskrilvvdddqamaaaiervlkrdhwqveiahngfdagiklstfepaimtldlsm
    pkldgldvirslrqnkvanqpkilvvsgldkaklqqavtegaddylekpfdndalldrih
    dlvneghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lteD (D:)
    slkqskrilvvdddqamaaaiervlkrdhwqveiahngfdagiklstfepaimtldlsmp
    kldgldvirslrqnkvanqpkilvvsgldkaklqqavtegaddylekpfdndalldrihd
    lvn
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3lteE (E:)
    mslkqskrilvvdddqamaaaiervlkrdhwqveiahngfdagiklstfepaimtldlsm
    pkldgldvirslrqnkvanqpkilvvsgldkaklqqavtegaddylekpfdndalldrih
    dlvneghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lteE (E:)
    slkqskrilvvdddqamaaaiervlkrdhwqveiahngfdagiklstfepaimtldlsmp
    kldgldvirslrqnkvanqpkilvvsgldkaklqqavtegaddylekpfdndalldrihd
    lvn
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3lteF (F:)
    mslkqskrilvvdddqamaaaiervlkrdhwqveiahngfdagiklstfepaimtldlsm
    pkldgldvirslrqnkvanqpkilvvsgldkaklqqavtegaddylekpfdndalldrih
    dlvneghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lteF (F:)
    slkqskrilvvdddqamaaaiervlkrdhwqveiahngfdagiklstfepaimtldlsmp
    kldgldvirslrqnkvanqpkilvvsgldkaklqqavtegaddylekpfdndalldrihd
    lvn
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3lteG (G:)
    mslkqskrilvvdddqamaaaiervlkrdhwqveiahngfdagiklstfepaimtldlsm
    pkldgldvirslrqnkvanqpkilvvsgldkaklqqavtegaddylekpfdndalldrih
    dlvneghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lteG (G:)
    qskrilvvdddqamaaaiervlkrdhwqveiahngfdagiklstfepaimtldlsmpkld
    gldvirslrqnkvanqpkilvvsgldkaklqqavtegaddylekpfdndalldrihdlvn
    e
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3lteH (H:)
    mslkqskrilvvdddqamaaaiervlkrdhwqveiahngfdagiklstfepaimtldlsm
    pkldgldvirslrqnkvanqpkilvvsgldkaklqqavtegaddylekpfdndalldrih
    dlvneghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lteH (H:)
    slkqskrilvvdddqamaaaiervlkrdhwqveiahngfdagiklstfepaimtldlsmp
    kldgldvirslrqnkvanqpkilvvsgldkaklqqavtegaddylekpfdndalldrihd
    lvn
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3lteI (I:)
    mslkqskrilvvdddqamaaaiervlkrdhwqveiahngfdagiklstfepaimtldlsm
    pkldgldvirslrqnkvanqpkilvvsgldkaklqqavtegaddylekpfdndalldrih
    dlvneghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lteI (I:)
    krilvvdddqamaaaiervlkrdhwqveiahngfdagiklstfepaimtldlsmpkldgl
    dvirslrqnkvanqpkilvvsgldkaklqqavtegaddylekpfdndalldrihdlvne
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >3lteJ (J:)
    mslkqskrilvvdddqamaaaiervlkrdhwqveiahngfdagiklstfepaimtldlsm
    pkldgldvirslrqnkvanqpkilvvsgldkaklqqavtegaddylekpfdndalldrih
    dlvneghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lteJ (J:)
    qskrilvvdddqamaaaiervlkrdhwqveiahngfdagiklstfepaimtldlsmpkld
    gldvirslrqnkvanqpkilvvsgldkaklqqavtegaddylekpfdndalldrihdlvn
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >3lteK (K:)
    mslkqskrilvvdddqamaaaiervlkrdhwqveiahngfdagiklstfepaimtldlsm
    pkldgldvirslrqnkvanqpkilvvsgldkaklqqavtegaddylekpfdndalldrih
    dlvneghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lteK (K:)
    qskrilvvdddqamaaaiervlkrdhwqveiahngfdagiklstfepaimtldlsmpkld
    gldvirslrqnkvanqpkilvvsgldkaklqqavtegaddylekpfdndalldrihdlvn
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3lteL (L:)
    mslkqskrilvvdddqamaaaiervlkrdhwqveiahngfdagiklstfepaimtldlsm
    pkldgldvirslrqnkvanqpkilvvsgldkaklqqavtegaddylekpfdndalldrih
    dlvneghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lteL (L:)
    skrilvvdddqamaaaiervlkrdhwqveiahngfdagiklstfepaimtldlsmpkldg
    ldvirslrqnkvanqpkilvvsgldkaklqqavtegaddylekpfdndalldrihdlv
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >3lteM (M:)
    mslkqskrilvvdddqamaaaiervlkrdhwqveiahngfdagiklstfepaimtldlsm
    pkldgldvirslrqnkvanqpkilvvsgldkaklqqavtegaddylekpfdndalldrih
    dlvneghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lteM (M:)
    skrilvvdddqamaaaiervlkrdhwqveiahngfdagiklstfepaimtldlsmpkldg
    ldvirslrqnkvanqpkilvvsgldkaklqqavtegaddylekpfdndalldrihdlv
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >3lteN (N:)
    mslkqskrilvvdddqamaaaiervlkrdhwqveiahngfdagiklstfepaimtldlsm
    pkldgldvirslrqnkvanqpkilvvsgldkaklqqavtegaddylekpfdndalldrih
    dlvneghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lteN (N:)
    skrilvvdddqamaaaiervlkrdhwqveiahngfdagiklstfepaimtldlsmpkldg
    ldvirslrqnkvanqpkilvvsgldkaklqqavtegaddylekpfdndalldrihdlvn
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >3lteO (O:)
    mslkqskrilvvdddqamaaaiervlkrdhwqveiahngfdagiklstfepaimtldlsm
    pkldgldvirslrqnkvanqpkilvvsgldkaklqqavtegaddylekpfdndalldrih
    dlvneghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lteO (O:)
    krilvvdddqamaaaiervlkrdhwqveiahngfdagiklstfepaimtldlsmpkldgl
    dvirslrqnkvanqpkilvvsgldkaklqqavtegaddylekpfdndalldrihdlv
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >3lteP (P:)
    mslkqskrilvvdddqamaaaiervlkrdhwqveiahngfdagiklstfepaimtldlsm
    pkldgldvirslrqnkvanqpkilvvsgldkaklqqavtegaddylekpfdndalldrih
    dlvneghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lteP (P:)
    slkqskrilvvdddqamaaaiervlkrdhwqveiahngfdagiklstfepaimtldlsmp
    kldgldvirslrqnkvanqpkilvvsgldkaklqqavtegaddylekpfdndalldrihd
    lvn
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >3lteQ (Q:)
    mslkqskrilvvdddqamaaaiervlkrdhwqveiahngfdagiklstfepaimtldlsm
    pkldgldvirslrqnkvanqpkilvvsgldkaklqqavtegaddylekpfdndalldrih
    dlvneghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lteQ (Q:)
    rilvvdddqamaaaiervlkrdhwqveiahngfdagiklstfepaimtldlsmpkldgld
    virslrqnkvanqpkilvvsgldkaklqqavtegaddylekpfdndalldrihdlvn
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >3lteR (R:)
    mslkqskrilvvdddqamaaaiervlkrdhwqveiahngfdagiklstfepaimtldlsm
    pkldgldvirslrqnkvanqpkilvvsgldkaklqqavtegaddylekpfdndalldrih
    dlvneghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lteR (R:)
    skrilvvdddqamaaaiervlkrdhwqveiahngfdagiklstfepaimtldlsmpkldg
    ldvirslrqnkvanqpkilvvsgldkaklqqavtegaddylekpfdndalldrihdlv
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >3lteS (S:)
    mslkqskrilvvdddqamaaaiervlkrdhwqveiahngfdagiklstfepaimtldlsm
    pkldgldvirslrqnkvanqpkilvvsgldkaklqqavtegaddylekpfdndalldrih
    dlvneghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lteS (S:)
    qskrilvvdddqamaaaiervlkrdhwqveiahngfdagiklstfepaimtldlsmpkld
    gldvirslrqnkvanqpkilvvsgldkaklqqavtegaddylekpfdndalldrihdlvn
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >3lteT (T:)
    mslkqskrilvvdddqamaaaiervlkrdhwqveiahngfdagiklstfepaimtldlsm
    pkldgldvirslrqnkvanqpkilvvsgldkaklqqavtegaddylekpfdndalldrih
    dlvneghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lteT (T:)
    skrilvvdddqamaaaiervlkrdhwqveiahngfdagiklstfepaimtldlsmpkldg
    ldvirslrqnkvanqpkilvvsgldkaklqqavtegaddylekpfdndalldrihdlvn
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >3lteU (U:)
    mslkqskrilvvdddqamaaaiervlkrdhwqveiahngfdagiklstfepaimtldlsm
    pkldgldvirslrqnkvanqpkilvvsgldkaklqqavtegaddylekpfdndalldrih
    dlvneghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lteU (U:)
    qskrilvvdddqamaaaiervlkrdhwqveiahngfdagiklstfepaimtldlsmpkld
    gldvirslrqnkvanqpkilvvsgldkaklqqavtegaddylekpfdndalldrihdlv
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >3lteV (V:)
    mslkqskrilvvdddqamaaaiervlkrdhwqveiahngfdagiklstfepaimtldlsm
    pkldgldvirslrqnkvanqpkilvvsgldkaklqqavtegaddylekpfdndalldrih
    dlvneghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lteV (V:)
    skrilvvdddqamaaaiervlkrdhwqveiahngfdagiklstfepaimtldlsmpkldg
    ldvirslrqnkvanqpkilvvsgldkaklqqavtegaddylekpfdndalldrihdlv
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >3lteW (W:)
    mslkqskrilvvdddqamaaaiervlkrdhwqveiahngfdagiklstfepaimtldlsm
    pkldgldvirslrqnkvanqpkilvvsgldkaklqqavtegaddylekpfdndalldrih
    dlvneghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lteW (W:)
    qskrilvvdddqamaaaiervlkrdhwqveiahngfdagiklstfepaimtldlsmpkld
    gldvirslrqnkvanqpkilvvsgldkaklqqavtegaddylekpfdndalldrihdlvn
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >3lteX (X:)
    mslkqskrilvvdddqamaaaiervlkrdhwqveiahngfdagiklstfepaimtldlsm
    pkldgldvirslrqnkvanqpkilvvsgldkaklqqavtegaddylekpfdndalldrih
    dlvneghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lteX (X:)
    skrilvvdddqamaaaiervlkrdhwqveiahngfdagiklstfepaimtldlsmpkldg
    ldvirslrqnkvanqpkilvvsgldkaklqqavtegaddylekpfdndalldrihdlv