PDB entry 3lsu

View 3lsu on RCSB PDB site
Description: Crystal Structure of SOD2 from Saccharomyces cerevisiae
Class: oxidoreductase
Keywords: Mn Superoxide Dismutase, reductive methylation, Manganese, Metal-binding, Mitochondrion, Oxidoreductase, Phosphoprotein, Transit peptide
Deposited on 2010-02-12, released 2011-02-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Superoxide dismutase [Mn], mitochondrial
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: SOD2, YHR008C
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3lsua1, d3lsua2
  • Chain 'B':
    Compound: Superoxide dismutase [Mn], mitochondrial
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: SOD2, YHR008C
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3lsub1, d3lsub2
  • Chain 'C':
    Compound: Superoxide dismutase [Mn], mitochondrial
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: SOD2, YHR008C
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3lsuc1, d3lsuc2
  • Chain 'D':
    Compound: Superoxide dismutase [Mn], mitochondrial
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: SOD2, YHR008C
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3lsud1, d3lsud2
  • Heterogens: MN, GOL, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3lsuA (A:)
    kvtlpdlkwdfgalepyisgqinelhytkhhqtyvngfntavdqfqelsdllakepspan
    arkmiaiqqnikfhgggftnhclfwenlapesqgggepptgalakaideqfgsldelikl
    tntklagvqgsgwafivknlsnggkldvvqtynqdtvtgplvplvaidawehayylqyqn
    kkadyfkaiwnvvnwkeasrrfdagki
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lsuA (A:)
    kvtlpdlkwdfgalepyisgqinelhytkhhqtyvngfntavdqfqelsdllakepspan
    arkmiaiqqnikfhgggftnhclfwenlapesqgggepptgalakaideqfgsldelikl
    tntklagvqgsgwafivknlsnggkldvvqtynqdtvtgplvplvaidawehayylqyqn
    kkadyfkaiwnvvnwkeasrrfdagk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3lsuB (B:)
    kvtlpdlkwdfgalepyisgqinelhytkhhqtyvngfntavdqfqelsdllakepspan
    arkmiaiqqnikfhgggftnhclfwenlapesqgggepptgalakaideqfgsldelikl
    tntklagvqgsgwafivknlsnggkldvvqtynqdtvtgplvplvaidawehayylqyqn
    kkadyfkaiwnvvnwkeasrrfdagki
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3lsuC (C:)
    kvtlpdlkwdfgalepyisgqinelhytkhhqtyvngfntavdqfqelsdllakepspan
    arkmiaiqqnikfhgggftnhclfwenlapesqgggepptgalakaideqfgsldelikl
    tntklagvqgsgwafivknlsnggkldvvqtynqdtvtgplvplvaidawehayylqyqn
    kkadyfkaiwnvvnwkeasrrfdagki
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lsuC (C:)
    kvtlpdlkwdfgalepyisgqinelhytkhhqtyvngfntavdqfqelsdllakepspan
    arkmiaiqqnikfhgggftnhclfwenlapesqgggepptgalakaideqfgsldelikl
    tntklagvqgsgwafivknlsnggkldvvqtynqdtvtgplvplvaidawehayylqyqn
    kkadyfkaiwnvvnwkeasrrfdagk
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3lsuD (D:)
    kvtlpdlkwdfgalepyisgqinelhytkhhqtyvngfntavdqfqelsdllakepspan
    arkmiaiqqnikfhgggftnhclfwenlapesqgggepptgalakaideqfgsldelikl
    tntklagvqgsgwafivknlsnggkldvvqtynqdtvtgplvplvaidawehayylqyqn
    kkadyfkaiwnvvnwkeasrrfdagki