PDB entry 3lsn

View 3lsn on RCSB PDB site
Description: Crystal structure of putative geranyltranstransferase from PSEUDOMONAS fluorescens PF-5 complexed with magnesium
Class: transferase
Keywords: STRUCTURAL GENOMICS, PROTEIN STRUCTURE INITIATIVE, NEW YORK STRUCTURAL GENOMIX RESEARCH CONSORTIUM, NYSGXRC, ISOPRENE BIOSYNTHESIS, Transferase, PSI-2, New York SGX Research Center for Structural Genomics
Deposited on 2010-02-12, released 2010-03-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: 0.18
AEROSPACI score: 0.73 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Geranyltranstransferase
    Species: Pseudomonas fluorescens [TaxId:220664]
    Gene: PFL_5509
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q4K5A6 (3-End)
      • expression tag (1-2)
    Domains in SCOPe 2.06: d3lsna1, d3lsna2
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3lsnA (A:)
    msltayqassqarvdaamhtlftapspelarlyeamrysvmnggkrvrpllayaacealg
    gkpeqangaacavelihayslvhddlpamddddlrrgqptthkafdeacailagdglqsl
    afsalldpalsdasaeirlrmvttlaqaagpagmvggqaidlgsvglkldqqaleymhrh
    ktgalieasvilgalasgraekgelkalqtyaqaiglafqvqddildvesdtatlgkrqg
    adiardkptypallglaaakeyalelrdqalhalrpfdaaaeplrelaryiverrseghh
    hhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lsnA (A:)
    sltayqassqarvdaamhtlftapspelarlyeamrysvmnggkrvrpllayaacealgg
    kpeqangaacavelihayslvhddlpamddddlrrgqptthkafdeacailagdglqsla
    fsalldpalsdasaeirlrmvttlaqaagpagmvggqaidlgsvglkldqqaleymhrhk
    tgalieasvilgalasgraekgelkalqtyaqaiglafqvqddildvesdtatlptypal
    lglaaakeyalelrdqalhalrpfdaaaeplrelaryive