PDB entry 3lsd

View 3lsd on RCSB PDB site
Description: N-Domain of human adhesion/growth-regulatory galectin-9
Class: sugar binding protein
Keywords: MANINLY BETA, Alternative splicing, Cytoplasm, Lectin, Polymorphism, Secreted, SUGAR BINDING PROTEIN
Deposited on 2010-02-12, released 2010-05-05
The last revision prior to the SCOPe 2.05 freeze date was dated 2010-05-19, with a file datestamp of 2010-05-14.
Experiment type: XRAY
Resolution: 2.03 Å
R-factor: 0.194
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Galectin-9
    Species: Homo sapiens [TaxId:9606]
    Gene: LGALS9
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3lsda_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3lsdA (A:)
    sqapylspavpfsgtiqgglqdglqitvngtvlsssgtrfavnfqtgfsgndiafhfnpr
    fedggyvvcntrqngswgpeerkthmpfqkgmpfdlcflvqssdfkvmvngilfvqyfhr
    vpfhrvdtisvngsvqlsyisfq