PDB entry 3lrp

View 3lrp on RCSB PDB site
Description: Crystal Structure of Plasmodium falciparum ADP-Ribosylation Factor 1
Class: protein transport
Keywords: ADP-ribosylation factor, Protein trafficking, ER-Golgi transport, Golgi apparatus, GTP-binding, Lipoprotein, Myristate, Nucleotide-binding, Protein transport, Transport, SIGNALING PROTEIN
Deposited on 2010-02-11, released 2010-11-10
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-06-19, with a file datestamp of 2013-06-14.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.189
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ADP-ribosylation factor 1
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: ARF1, ARF, PLARF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3lrpa_
  • Heterogens: GDP, MG, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3lrpA (A:)
mglyvsrlfnrlfqkkdvrilmvgldaagkttilykvklgevvttiptigfnvetvefrn
isftvwdvggqdkirplwrhyysntdglifvvdsndreriddareelhrmineeelkdai
ilvfankqdlpnamsaaevteklhlntirernwfiqstcatrgdglyegfdwltthlnna
k