PDB entry 3lrh

View 3lrh on RCSB PDB site
Description: Structure of anti-huntingtin VL domain in complex with huntingtin peptide
Class: immune system
Keywords: Huntington's disease, Huntingtin, Variable light chain domain, Intrabody, Immunoglobulin, IMMUNE SYSTEM
Deposited on 2010-02-11, released 2011-02-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-01-11, with a file datestamp of 2012-01-06.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.219
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: anti-huntingtin VL domain
    Species: Homo sapiens [TaxId:9606]
    Gene: VL12.3
    Database cross-references and differences (RAF-indexed):
    • PDB 3LRH
  • Chain 'B':
    Compound: Huntingtin
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: anti-huntingtin VL domain
    Species: Homo sapiens [TaxId:9606]
    Gene: VL12.3
    Database cross-references and differences (RAF-indexed):
    • PDB 3LRH
  • Chain 'D':
    Compound: Huntingtin
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: anti-huntingtin VL domain
    Species: Homo sapiens [TaxId:9606]
    Gene: VL12.3
    Database cross-references and differences (RAF-indexed):
    • PDB 3LRH
  • Chain 'F':
    Compound: Huntingtin
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: anti-huntingtin VL domain
    Species: Homo sapiens [TaxId:9606]
    Gene: VL12.3
    Database cross-references and differences (RAF-indexed):
    • PDB 3LRH
  • Chain 'H':
    Compound: Huntingtin
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'I':
    Compound: anti-huntingtin VL domain
    Species: Homo sapiens [TaxId:9606]
    Gene: VL12.3
    Database cross-references and differences (RAF-indexed):
    • PDB 3LRH
  • Chain 'J':
    Compound: Huntingtin
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'K':
    Compound: anti-huntingtin VL domain
    Species: Homo sapiens [TaxId:9606]
    Gene: VL12.3
    Database cross-references and differences (RAF-indexed):
    • PDB 3LRH
  • Chain 'L':
    Compound: Huntingtin
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'M':
    Compound: anti-huntingtin VL domain
    Species: Homo sapiens [TaxId:9606]
    Gene: VL12.3
    Database cross-references and differences (RAF-indexed):
    • PDB 3LRH
  • Chain 'N':
    Compound: Huntingtin
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'O':
    Compound: anti-huntingtin VL domain
    Species: Homo sapiens [TaxId:9606]
    Gene: VL12.3
    Database cross-references and differences (RAF-indexed):
    • PDB 3LRH
    Domains in SCOPe 2.07: d3lrho_
  • Chain 'P':
    Compound: Huntingtin
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    No sequence available.

  • Chain 'M':
    No sequence available.

  • Chain 'N':
    No sequence available.

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >3lrhO (O:)
    mgsqpvltqspsvsaaprqrvtisvsgsnsnigsntvnwiqqlpgrapellmydddllap
    gvsdrfsgsrsgtsasltisglqsedeadyyaatwddslngwvfgggtkvtvlsahhhhh
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lrhO (O:)
    sqpvltqspsvsaaprqrvtisvsgsnsnigsntvnwiqqlpgrapellmydddllapgv
    sdrfsgsrsgtsasltisglqsedeadyyaatwddslngwvfgggtkvtvl
    

  • Chain 'P':
    No sequence available.