PDB entry 3lps

View 3lps on RCSB PDB site
Description: Crystal structure of parE
Class: isomerase/antibiotic
Keywords: topoisomeraseIV, parE, novobiocin, ATP-binding, Isomerase, Nucleotide-binding, Topoisomerase, ISOMERASE-ANTIBIOTIC complex
Deposited on 2010-02-05, released 2011-02-16
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-02-16, with a file datestamp of 2011-02-11.
Experiment type: XRAY
Resolution: 2.29 Å
R-factor: 0.228
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Topoisomerase IV subunit B
    Species: Xanthomonas oryzae pv. oryzae [TaxId:291331]
    Gene: parE, XOO2969
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3lpsa1, d3lpsa2
  • Heterogens: NOV, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3lpsA (A:)
    mgsshhhhhhssglvprgshntrynaadievlsgldpvkrrpgmytdtarpnhlaqevid
    nsvdealaghakqievtlykdgscevsddgrgmpvdihpeekipgveliltrlhaggkfn
    nrnytfsgglhgvgvsvvnalstkvelfikregsehrmefrdgnaasklevvgtvgkknt
    gtrlrfwadpkyfdtpkfnvralrhllrakavlcpgltvklhdeatgeqdswyfenglrd
    ylkgemaehemlpadlfvgslkkdteivdwaagwvpegelvqesyvnliptaqhgthvng
    lrsgltdalrefcdfrnllprgvklapedvwdrvtfvlslkmtdpqfsgqtkerlssrqa
    agfiegaahdafslylnqnveigekiaqiaidrasarlktekqivrkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lpsA (A:)
    gldpvkrrpgmytdtarpnhlaqevidnsvdealaghakqievtlykdgscevsddgrgm
    pvdihpeekipgveliltrlhgvgvsvvnalstkvelfikregsehrmefrdgnaaskle
    vvgtvgkkntgtrlrfwadpkyfdtpkfnvralrhllrakavlcpgltvklhdeatgeqd
    swyfenglrdylkgemaehemlpadlfvgslkkdteivdwaagwvpegelvqesyvnlip
    taqhgthvnglrsgltdalrefcdfrnllprgvklapedvwdrvtfvlslkmtdpqfsgq
    tkerlssrqaagfiegaahdafslylnqnveigekiaqiaidrasar