PDB entry 3lpl

View 3lpl on RCSB PDB site
Description: E. coli pyruvate dehydrogenase complex E1 component E571A mutant
Class: oxidoreductase
Keywords: THDP, PYRUVATE DEHYDROGENASE, OXIDOREDUCTASE, Glycolysis, Metal-binding, Pyruvate, Thiamine pyrophosphate
Deposited on 2010-02-05, released 2010-03-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-02-15, with a file datestamp of 2012-02-10.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.197
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pyruvate dehydrogenase E1 component
    Species: Escherichia coli [TaxId:83334]
    Gene: aceE, B0114, ECs0118, Z0124
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AFG9 (Start-885)
      • engineered mutation (570)
    Domains in SCOPe 2.07: d3lpla1, d3lpla2, d3lpla3
  • Chain 'B':
    Compound: Pyruvate dehydrogenase E1 component
    Species: Escherichia coli [TaxId:83334]
    Gene: aceE, B0114, ECs0118, Z0124
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AFG9 (Start-885)
      • engineered mutation (570)
    Domains in SCOPe 2.07: d3lplb1, d3lplb2, d3lplb3
  • Heterogens: EPE, TDP, MG, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3lplA (A:)
    serfpndvdpietrdwlqaiesvireegveraqylidqllaearkggvnvaagtgisnyi
    ntipveeqpeypgnlelerrirsairwnaimtvlraskkdlelgghmasfqssatiydvc
    fnhffrarneqdggdlvyfqghispgvyaraflegrltqeqldnfrqevhgnglssyphp
    klmpefwqfptvsmglgpigaiyqakflkylehrglkdtskqtvyaflgdgemdepeskg
    aitiatrekldnlvfvincnlqrldgpvtgngkiinelegifegagwnvikvmwgsrwde
    llrkdtsgkliqlmnetvdgdyqtfkskdgayvrehffgkypetaalvadwtdeqiwaln
    rgghdpkkiyaafkkaqetkgkatvilahtikgygmgdaaegkniahqvkkmnmdgvrhi
    rdrfnvpvsdadieklpyitfpegseehtylhaqrqklhgylpsrqpnfteklelpslqd
    fgalleeqskeisttiafvralnvmlknksikdrlvpiiadeartfgmeglfrqigiysp
    ngqqytpqdreqvayykedekgqilqeginalgagcswlaaatsystnnlpmipfyiyys
    mfgfqrigdlcwaagdqqargfliggtsgrttlngeglqhedghshiqsltipncisydp
    ayayevavimhdglermygekqenvyyyittlnenyhmpampegaeegirkgiykletie
    gskgkvqllgsgsilrhvreaaeilakdygvgsdvysvtsftelardgqdcerwnmlhpl
    etprvpyiaqvmndapavastdymklfaeqvrtyvpaddyrvlgtdgfgrsdsrenlrhh
    fevdasyvvvaalgelakrgeidkkvvadaiakfnidadkvnprla
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lplA (A:)
    isnyintipveeqpeypgnlelerrirsairwnaimtvlraskkdlelgghmasfqssat
    iydvcfnhffrarneqdggdlvyfqghispgvyaraflegrltqeqldnfrqevhgngls
    syphpklmpefwqfptvsmglgpigaiyqakflkylehrglkdtskqtvyaflgdgemde
    peskgaitiatrekldnlvfvincnlqrldgpvtgngkiinelegifegagwnvikvmwg
    srwdellrkdtsgkliqlmnetvdgdyqtfkskdgayvrehffgkypetaalvadwtdeq
    iwalnrgghdpkkiyaafkkaqetkgkatvilahtikgygmgdaamdgvrhirdrfnvpv
    sdadieklpyitfpegseehtylhaqrqklhgylpsrqpnfteklelpslqdfgalleeq
    skeisttiafvralnvmlknksikdrlvpiiadeartfgmeglfrqigiyspedekgqil
    qeginalgagcswlaaatsystnnlpmipfyiyysmfgfqrigdlcwaagdqqargflig
    gtsgrttlngeglqhedghshiqsltipncisydpayayevavimhdglermygekqenv
    yyyittlnenyhmpampegaeegirkgiykletiegskgkvqllgsgsilrhvreaaeil
    akdygvgsdvysvtsftelardgqdcerwnmlhpletprvpyiaqvmndapavastdymk
    lfaeqvrtyvpaddyrvlgtdgfgrsdsrenlrhhfevdasyvvvaalgelakrgeidkk
    vvadaiakfnidadkvnprla
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3lplB (B:)
    serfpndvdpietrdwlqaiesvireegveraqylidqllaearkggvnvaagtgisnyi
    ntipveeqpeypgnlelerrirsairwnaimtvlraskkdlelgghmasfqssatiydvc
    fnhffrarneqdggdlvyfqghispgvyaraflegrltqeqldnfrqevhgnglssyphp
    klmpefwqfptvsmglgpigaiyqakflkylehrglkdtskqtvyaflgdgemdepeskg
    aitiatrekldnlvfvincnlqrldgpvtgngkiinelegifegagwnvikvmwgsrwde
    llrkdtsgkliqlmnetvdgdyqtfkskdgayvrehffgkypetaalvadwtdeqiwaln
    rgghdpkkiyaafkkaqetkgkatvilahtikgygmgdaaegkniahqvkkmnmdgvrhi
    rdrfnvpvsdadieklpyitfpegseehtylhaqrqklhgylpsrqpnfteklelpslqd
    fgalleeqskeisttiafvralnvmlknksikdrlvpiiadeartfgmeglfrqigiysp
    ngqqytpqdreqvayykedekgqilqeginalgagcswlaaatsystnnlpmipfyiyys
    mfgfqrigdlcwaagdqqargfliggtsgrttlngeglqhedghshiqsltipncisydp
    ayayevavimhdglermygekqenvyyyittlnenyhmpampegaeegirkgiykletie
    gskgkvqllgsgsilrhvreaaeilakdygvgsdvysvtsftelardgqdcerwnmlhpl
    etprvpyiaqvmndapavastdymklfaeqvrtyvpaddyrvlgtdgfgrsdsrenlrhh
    fevdasyvvvaalgelakrgeidkkvvadaiakfnidadkvnprla
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lplB (B:)
    isnyintipveeqpeypgnlelerrirsairwnaimtvlraskkdlelgghmasfqssat
    iydvcfnhffrarneqdggdlvyfqghispgvyaraflegrltqeqldnfrqevhgngls
    syphpklmpefwqfptvsmglgpigaiyqakflkylehrglkdtskqtvyaflgdgemde
    peskgaitiatrekldnlvfvincnlqrldgpvtgngkiinelegifegagwnvikvmwg
    srwdellrkdtsgkliqlmnetvdgdyqtfkskdgayvrehffgkypetaalvadwtdeq
    iwalnrgghdpkkiyaafkkaqetkgkatvilahtikgygmgdaamdgvrhirdrfnvpv
    sdadieklpyitfpegseehtylhaqrqklhgylpsrqpnfteklelpslqdfgalleeq
    skeisttiafvralnvmlknksikdrlvpiiadeartfgmeglfrqigiyspedekgqil
    qeginalgagcswlaaatsystnnlpmipfyiyysmfgfqrigdlcwaagdqqargflig
    gtsgrttlngeglqhedghshiqsltipncisydpayayevavimhdglermygekqenv
    yyyittlnenyhmpampegaeegirkgiykletiegskgkvqllgsgsilrhvreaaeil
    akdygvgsdvysvtsftelardgqdcerwnmlhpletprvpyiaqvmndapavastdymk
    lfaeqvrtyvpaddyrvlgtdgfgrsdsrenlrhhfevdasyvvvaalgelakrgeidkk
    vvadaiakfnidadkvnprla