PDB entry 3lp8

View 3lp8 on RCSB PDB site
Description: Crystal structure of phosphoribosylamine-glycine ligase from Ehrlichia chaffeensis
Class: ligase
Keywords: SSGCID, NIH, NIAID, SBRI, UW, emerald biostructures, ALS collaborative crystallography, Ehrlichia chaffeensis, phosphoribosylamine-glycine ligase, Ligase, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease
Deposited on 2010-02-04, released 2010-02-23
The last revision prior to the SCOPe 2.04 freeze date was dated 2010-02-23, with a file datestamp of 2010-02-19.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.172
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphoribosylamine-glycine ligase
    Species: Ehrlichia chaffeensis [TaxId:205920]
    Gene: purD, ECH_1006
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2GFJ0 (21-End)
      • expression tag (19-20)
    Domains in SCOPe 2.04: d3lp8a1, d3lp8a2, d3lp8a3
  • Heterogens: PO4, UNX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3lp8A (A:)
    mahhhhhhmgtleaqtqgpgsmnvlvigsggrehsmlhhirkstllnklfiapgregmsg
    ladiididinstieviqvckkekielvvigpetplmnglsdalteegilvfgpskaaarl
    esskgftkelcmrygiptakygyfvdtnsaykfidkhklplvvkadglaqgkgtvichth
    eeaynavdamlvhhkfgeagcaiiieeflegkeisfftlvdgsnpvilgvaqdyktigdn
    nkgpntggmgsyskpniitqemehiiiqkiiyptikamfnmniqfrgllfagiiikknep
    klleynvrfgdpetqsilprlnsdflkllsltakgklgnesvelskkaalcvvvasrgyp
    geykknsiingienieklpnvqllhagtrregnnwvsdsgrvinvvaqgenlasakhqay
    aaldlldwpdgiyrydigscal
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lp8A (A:)
    gsmnvlvigsggrehsmlhhirkstllnklfiapgregmsgladiididinstieviqvc
    kkekielvvigpetplmnglsdalteegilvfgpskaaarlesskgftkelcmrygipta
    kygyfvdtnsaykfidkhklplvvkadglaqgkgtvichtheeaynavdamlvhhkfgea
    gcaiiieeflegkeisfftlvdgsnpvilgvaqdyktigdnnkgpntggmgsyskpniit
    qemehiiiqkiiyptikamfnmniqfrgllfagiiikknepklleynvrfgdpetqsilp
    rlnsdflkllsltakgklgnesvelskkaalcvvvasrgypgeykknsiingienieklp
    nvqllhagtrregnnwvsdsgrvinvvaqgenlasakhqayaaldlldwpdgiyrydigs
    c