PDB entry 3lom

View 3lom on RCSB PDB site
Description: CRYSTAL STRUCTURE OF GERANYLTRANSFERASE FROM Legionella pneumophila
Class: transferase
Keywords: GERANYLTRANSFERASE, STRUCTURAL GENOMICS, PSI, PROTEIN STRUCTURE INITIATIVE, NYSGRC, NEW YORK STRUCTURAL GENOMIX RESEARCH CONSORTIUM, NYSGXRC, Isoprene biosynthesis, Transferase, New York SGX Research Center for Structural Genomics
Deposited on 2010-02-04, released 2010-02-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-04-10, with a file datestamp of 2013-04-05.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.222
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Geranyltranstransferase
    Species: Legionella pneumophila subsp. pneumophila [TaxId:272624]
    Gene: ispA, lpg2330
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5ZT35 (Start-304)
      • expression tag (305)
    Domains in SCOPe 2.07: d3loma1, d3loma2
  • Chain 'B':
    Compound: Geranyltranstransferase
    Species: Legionella pneumophila subsp. pneumophila [TaxId:272624]
    Gene: ispA, lpg2330
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3lomb_
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3lomA (A:)
    mslnstqmnkqvidkytqrhelyleqllneiiipapqirsalhyalfsggkrirpilvyl
    agdlidvdqgvldiiaaalelthcyslihddlpamdnddlrrgkpschkafdeatailvg
    dgmqalaievllmrlspllpaaqvvaitqvlvnasgisgmvsgqsldlselakssvteeq
    lreihllktgklilacfemvlaaqhevseqiksalrtygkhiglvfqmqddyldlyaptq
    ilgkgrssdqanqkttfatlfnkqqleeeiavhyqiamdslrlfgskaaalieltkqlqn
    rsnlseghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lomA (A:)
    nstqmnkqvidkytqrhelyleqllneiiipapqirsalhyalfsggkrirpilvylagd
    lidvdqgvldiiaaalelthcyslihddlpamdnddlrrgkpschkafdeatailvgdgm
    qalaievllmrlspllpaaqvvaitqvlvnasgisgmvsgqsldlselakssvteeqlre
    ihllktgklilacfemvlaaqhevseqiksalrtygkhiglvfqmqddyldlyapkttfa
    tlfnkqqleeeiavhyqiamdslrlfgskaaalieltkqlqnrsnlse
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3lomB (B:)
    mslnstqmnkqvidkytqrhelyleqllneiiipapqirsalhyalfsggkrirpilvyl
    agdlidvdqgvldiiaaalelthcyslihddlpamdnddlrrgkpschkafdeatailvg
    dgmqalaievllmrlspllpaaqvvaitqvlvnasgisgmvsgqsldlselakssvteeq
    lreihllktgklilacfemvlaaqhevseqiksalrtygkhiglvfqmqddyldlyaptq
    ilgkgrssdqanqkttfatlfnkqqleeeiavhyqiamdslrlfgskaaalieltkqlqn
    rsnlseghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lomB (B:)
    nstqmnkqvidkytqrhelyleqllneiiipapqirsalhyalfsggkrirpilvylagd
    lidvdqgvldiiaaalelthcyslihddlpamdnddlrrgkpschkafdeatailvgdgm
    qalaievllmrlspllpaaqvvaitqvlvnasgisgmvsgqsldlselakssvteeqlre
    ihllktgklilacfemvlaaqhevseqiksalrtygkhiglvfqmqddyldlyakttfat
    lfnkqqleeeiavhyqiamdslrlfgskaaalieltkqlqnrsnl