PDB entry 3lo5

View 3lo5 on RCSB PDB site
Description: Crystal Structure of the dominant negative S17N mutant of Ras
Class: oncoprotein
Keywords: Ras, nucleotide exchange, dominant negative, Mg2+, Acetylation, Cell membrane, Disease mutation, Golgi apparatus, GTP-binding, Lipoprotein, Membrane, Methylation, Nucleotide-binding, Palmitate, Prenylation, Proto-oncogene, S-nitrosylation, ONCOPROTEIN
Deposited on 2010-02-03, released 2010-03-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-03-16, with a file datestamp of 2010-03-12.
Experiment type: XRAY
Resolution: 2.57 Å
R-factor: 0.241
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: gtpase hras
    Species: Homo sapiens [TaxId:9606]
    Gene: H-Ras, HRAS, HRAS1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01112 (0-165)
      • engineered (16)
    Domains in SCOPe 2.06: d3lo5a_
  • Chain 'C':
    Compound: gtpase hras
    Species: Homo sapiens [TaxId:9606]
    Gene: H-Ras, HRAS, HRAS1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01112 (0-165)
      • engineered (16)
    Domains in SCOPe 2.06: d3lo5c_
  • Chain 'E':
    Compound: gtpase hras
    Species: Homo sapiens [TaxId:9606]
    Gene: H-Ras, HRAS, HRAS1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01112 (0-165)
      • engineered (16)
    Domains in SCOPe 2.06: d3lo5e_
  • Heterogens: GDP, CA, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3lo5A (A:)
    mteyklvvvgaggvgknaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
    qeeysamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdl
    aartvesrqaqdlarsygipyietsaktrqgvedafytlvreirqh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lo5A (A:)
    mteyklvvvgaggvgknaltiqliqnhfvdsyrkqvvidgetclldildmrtgegflcvf
    ainntksfedihqyreqikrvkdsddvpmvlvgnkcdlaartvesrqaqdlarsygipyi
    etsaktrqgvedafytlvreirqh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3lo5C (C:)
    mteyklvvvgaggvgknaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
    qeeysamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdl
    aartvesrqaqdlarsygipyietsaktrqgvedafytlvreirqh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lo5C (C:)
    mteyklvvvgaggvgknaltiqliqnhsyrkqvvidgetclldildtagqeeysamrdqy
    mrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdlaartvesrqaq
    dlarsygipyietsaktrqgvedafytlvreirqh
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3lo5E (E:)
    mteyklvvvgaggvgknaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
    qeeysamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdl
    aartvesrqaqdlarsygipyietsaktrqgvedafytlvreirqh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lo5E (E:)
    mteyklvvvgaggvgknaltiqliqnhfvdeydptiedsyrkqvvidgetclldilmrtg
    egflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdlaartvesrqaqdlar
    sygipyietsaktrqgvedafytlvreirqh