PDB entry 3lo3

View 3lo3 on RCSB PDB site
Description: The crystal structure of a conserved functionally unknown protein from Colwellia psychrerythraea 34H.
Class: structure genomics, unknown function
Keywords: structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG, structure genomics, unknown function
Deposited on 2010-02-03, released 2010-02-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-09-05, with a file datestamp of 2012-08-31.
Experiment type: XRAY
Resolution: 2.38 Å
R-factor: 0.195
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: uncharacterized conserved protein
    Species: Colwellia psychrerythraea [TaxId:167879]
    Gene: CPS_1673
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q484V4 (3-93)
      • expression tag (0-2)
    Domains in SCOPe 2.08: d3lo3a1, d3lo3a2
  • Chain 'B':
    Compound: uncharacterized conserved protein
    Species: Colwellia psychrerythraea [TaxId:167879]
    Gene: CPS_1673
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q484V4 (3-93)
      • expression tag (0-2)
    Domains in SCOPe 2.08: d3lo3b1, d3lo3b2
  • Chain 'C':
    Compound: uncharacterized conserved protein
    Species: Colwellia psychrerythraea [TaxId:167879]
    Gene: CPS_1673
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q484V4 (3-93)
      • expression tag (0-2)
    Domains in SCOPe 2.08: d3lo3c1, d3lo3c2
  • Chain 'D':
    Compound: uncharacterized conserved protein
    Species: Colwellia psychrerythraea [TaxId:167879]
    Gene: CPS_1673
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q484V4 (3-93)
      • expression tag (0-2)
    Domains in SCOPe 2.08: d3lo3d1, d3lo3d2
  • Chain 'E':
    Compound: uncharacterized conserved protein
    Species: Colwellia psychrerythraea [TaxId:167879]
    Gene: CPS_1673
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q484V4 (3-93)
      • expression tag (0-2)
    Domains in SCOPe 2.08: d3lo3e1, d3lo3e2
  • Chain 'F':
    Compound: uncharacterized conserved protein
    Species: Colwellia psychrerythraea [TaxId:167879]
    Gene: CPS_1673
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q484V4 (3-93)
      • expression tag (0-2)
    Domains in SCOPe 2.08: d3lo3f1, d3lo3f2
  • Chain 'G':
    Compound: uncharacterized conserved protein
    Species: Colwellia psychrerythraea [TaxId:167879]
    Gene: CPS_1673
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q484V4 (3-93)
      • expression tag (0-2)
    Domains in SCOPe 2.08: d3lo3g1, d3lo3g2
  • Chain 'H':
    Compound: uncharacterized conserved protein
    Species: Colwellia psychrerythraea [TaxId:167879]
    Gene: CPS_1673
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q484V4 (3-93)
      • expression tag (0-2)
    Domains in SCOPe 2.08: d3lo3h1, d3lo3h2
  • Chain 'I':
    Compound: uncharacterized conserved protein
    Species: Colwellia psychrerythraea [TaxId:167879]
    Gene: CPS_1673
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q484V4 (3-93)
      • expression tag (0-2)
    Domains in SCOPe 2.08: d3lo3i1, d3lo3i2
  • Chain 'J':
    Compound: uncharacterized conserved protein
    Species: Colwellia psychrerythraea [TaxId:167879]
    Gene: CPS_1673
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q484V4 (3-93)
      • expression tag (0-2)
    Domains in SCOPe 2.08: d3lo3j1, d3lo3j2
  • Chain 'K':
    Compound: uncharacterized conserved protein
    Species: Colwellia psychrerythraea [TaxId:167879]
    Gene: CPS_1673
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q484V4 (3-93)
      • expression tag (0-2)
    Domains in SCOPe 2.08: d3lo3k1, d3lo3k2
  • Chain 'L':
    Compound: uncharacterized conserved protein
    Species: Colwellia psychrerythraea [TaxId:167879]
    Gene: CPS_1673
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q484V4 (3-93)
      • expression tag (0-2)
    Domains in SCOPe 2.08: d3lo3l1, d3lo3l2
  • Chain 'M':
    Compound: uncharacterized conserved protein
    Species: Colwellia psychrerythraea [TaxId:167879]
    Gene: CPS_1673
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q484V4 (3-93)
      • expression tag (0-2)
    Domains in SCOPe 2.08: d3lo3m1, d3lo3m2
  • Chain 'N':
    Compound: uncharacterized conserved protein
    Species: Colwellia psychrerythraea [TaxId:167879]
    Gene: CPS_1673
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q484V4 (3-93)
      • expression tag (0-2)
    Domains in SCOPe 2.08: d3lo3n1, d3lo3n2
  • Chain 'O':
    Compound: uncharacterized conserved protein
    Species: Colwellia psychrerythraea [TaxId:167879]
    Gene: CPS_1673
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q484V4 (3-93)
      • expression tag (0-2)
    Domains in SCOPe 2.08: d3lo3o1, d3lo3o2
  • Chain 'P':
    Compound: uncharacterized conserved protein
    Species: Colwellia psychrerythraea [TaxId:167879]
    Gene: CPS_1673
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q484V4 (3-93)
      • expression tag (0-2)
    Domains in SCOPe 2.08: d3lo3p1, d3lo3p2
  • Chain 'Q':
    Compound: uncharacterized conserved protein
    Species: Colwellia psychrerythraea [TaxId:167879]
    Gene: CPS_1673
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q484V4 (3-93)
      • expression tag (0-2)
    Domains in SCOPe 2.08: d3lo3q1, d3lo3q2
  • Chain 'R':
    Compound: uncharacterized conserved protein
    Species: Colwellia psychrerythraea [TaxId:167879]
    Gene: CPS_1673
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q484V4 (3-93)
      • expression tag (0-2)
    Domains in SCOPe 2.08: d3lo3r1, d3lo3r2
  • Chain 'S':
    Compound: uncharacterized conserved protein
    Species: Colwellia psychrerythraea [TaxId:167879]
    Gene: CPS_1673
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q484V4 (3-93)
      • expression tag (0-2)
    Domains in SCOPe 2.08: d3lo3s1, d3lo3s2
  • Chain 'T':
    Compound: uncharacterized conserved protein
    Species: Colwellia psychrerythraea [TaxId:167879]
    Gene: CPS_1673
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q484V4 (3-93)
      • expression tag (0-2)
    Domains in SCOPe 2.08: d3lo3t1, d3lo3t2
  • Chain 'U':
    Compound: uncharacterized conserved protein
    Species: Colwellia psychrerythraea [TaxId:167879]
    Gene: CPS_1673
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q484V4 (3-93)
      • expression tag (0-2)
    Domains in SCOPe 2.08: d3lo3u1, d3lo3u2
  • Chain 'V':
    Compound: uncharacterized conserved protein
    Species: Colwellia psychrerythraea [TaxId:167879]
    Gene: CPS_1673
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q484V4 (3-93)
      • expression tag (0-2)
    Domains in SCOPe 2.08: d3lo3v1, d3lo3v2
  • Chain 'W':
    Compound: uncharacterized conserved protein
    Species: Colwellia psychrerythraea [TaxId:167879]
    Gene: CPS_1673
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q484V4 (3-93)
      • expression tag (0-2)
    Domains in SCOPe 2.08: d3lo3w1, d3lo3w2
  • Chain 'X':
    Compound: uncharacterized conserved protein
    Species: Colwellia psychrerythraea [TaxId:167879]
    Gene: CPS_1673
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q484V4 (3-93)
      • expression tag (0-2)
    Domains in SCOPe 2.08: d3lo3x1, d3lo3x2
  • Chain 'Y':
    Compound: uncharacterized conserved protein
    Species: Colwellia psychrerythraea [TaxId:167879]
    Gene: CPS_1673
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q484V4 (3-93)
      • expression tag (0-2)
    Domains in SCOPe 2.08: d3lo3y1, d3lo3y2
  • Chain 'Z':
    Compound: uncharacterized conserved protein
    Species: Colwellia psychrerythraea [TaxId:167879]
    Gene: CPS_1673
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q484V4 (3-93)
      • expression tag (0-2)
    Domains in SCOPe 2.08: d3lo3z1, d3lo3z2
  • Chain 'a':
    Compound: uncharacterized conserved protein
    Species: Colwellia psychrerythraea [TaxId:167879]
    Gene: CPS_1673
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q484V4 (3-93)
      • expression tag (0-2)
  • Chain 'b':
    Compound: uncharacterized conserved protein
    Species: Colwellia psychrerythraea [TaxId:167879]
    Gene: CPS_1673
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q484V4 (3-93)
      • expression tag (0-2)
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3lo3A (A:)
snatayiivgltpkdaeklqqygarvastlakysgevlvkgsveqlhgkfehkaqvilef
psredaynwyhseeyqalistrdlgmdsqfqlig

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3lo3B (B:)
snatayiivgltpkdaeklqqygarvastlakysgevlvkgsveqlhgkfehkaqvilef
psredaynwyhseeyqalistrdlgmdsqfqlig

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3lo3C (C:)
snatayiivgltpkdaeklqqygarvastlakysgevlvkgsveqlhgkfehkaqvilef
psredaynwyhseeyqalistrdlgmdsqfqlig

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3lo3D (D:)
snatayiivgltpkdaeklqqygarvastlakysgevlvkgsveqlhgkfehkaqvilef
psredaynwyhseeyqalistrdlgmdsqfqlig

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3lo3E (E:)
snatayiivgltpkdaeklqqygarvastlakysgevlvkgsveqlhgkfehkaqvilef
psredaynwyhseeyqalistrdlgmdsqfqlig

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3lo3F (F:)
snatayiivgltpkdaeklqqygarvastlakysgevlvkgsveqlhgkfehkaqvilef
psredaynwyhseeyqalistrdlgmdsqfqlig

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3lo3G (G:)
snatayiivgltpkdaeklqqygarvastlakysgevlvkgsveqlhgkfehkaqvilef
psredaynwyhseeyqalistrdlgmdsqfqlig

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3lo3H (H:)
snatayiivgltpkdaeklqqygarvastlakysgevlvkgsveqlhgkfehkaqvilef
psredaynwyhseeyqalistrdlgmdsqfqlig

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3lo3I (I:)
snatayiivgltpkdaeklqqygarvastlakysgevlvkgsveqlhgkfehkaqvilef
psredaynwyhseeyqalistrdlgmdsqfqlig

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3lo3J (J:)
snatayiivgltpkdaeklqqygarvastlakysgevlvkgsveqlhgkfehkaqvilef
psredaynwyhseeyqalistrdlgmdsqfqlig

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3lo3K (K:)
snatayiivgltpkdaeklqqygarvastlakysgevlvkgsveqlhgkfehkaqvilef
psredaynwyhseeyqalistrdlgmdsqfqlig

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3lo3L (L:)
snatayiivgltpkdaeklqqygarvastlakysgevlvkgsveqlhgkfehkaqvilef
psredaynwyhseeyqalistrdlgmdsqfqlig

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3lo3M (M:)
snatayiivgltpkdaeklqqygarvastlakysgevlvkgsveqlhgkfehkaqvilef
psredaynwyhseeyqalistrdlgmdsqfqlig

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3lo3N (N:)
snatayiivgltpkdaeklqqygarvastlakysgevlvkgsveqlhgkfehkaqvilef
psredaynwyhseeyqalistrdlgmdsqfqlig

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3lo3O (O:)
snatayiivgltpkdaeklqqygarvastlakysgevlvkgsveqlhgkfehkaqvilef
psredaynwyhseeyqalistrdlgmdsqfqlig

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3lo3P (P:)
snatayiivgltpkdaeklqqygarvastlakysgevlvkgsveqlhgkfehkaqvilef
psredaynwyhseeyqalistrdlgmdsqfqlig

  • Chain 'Q':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3lo3Q (Q:)
snatayiivgltpkdaeklqqygarvastlakysgevlvkgsveqlhgkfehkaqvilef
psredaynwyhseeyqalistrdlgmdsqfqlig

  • Chain 'R':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3lo3R (R:)
snatayiivgltpkdaeklqqygarvastlakysgevlvkgsveqlhgkfehkaqvilef
psredaynwyhseeyqalistrdlgmdsqfqlig

  • Chain 'S':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3lo3S (S:)
snatayiivgltpkdaeklqqygarvastlakysgevlvkgsveqlhgkfehkaqvilef
psredaynwyhseeyqalistrdlgmdsqfqlig

  • Chain 'T':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3lo3T (T:)
snatayiivgltpkdaeklqqygarvastlakysgevlvkgsveqlhgkfehkaqvilef
psredaynwyhseeyqalistrdlgmdsqfqlig

  • Chain 'U':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3lo3U (U:)
snatayiivgltpkdaeklqqygarvastlakysgevlvkgsveqlhgkfehkaqvilef
psredaynwyhseeyqalistrdlgmdsqfqlig

  • Chain 'V':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3lo3V (V:)
snatayiivgltpkdaeklqqygarvastlakysgevlvkgsveqlhgkfehkaqvilef
psredaynwyhseeyqalistrdlgmdsqfqlig

  • Chain 'W':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3lo3W (W:)
snatayiivgltpkdaeklqqygarvastlakysgevlvkgsveqlhgkfehkaqvilef
psredaynwyhseeyqalistrdlgmdsqfqlig

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3lo3X (X:)
snatayiivgltpkdaeklqqygarvastlakysgevlvkgsveqlhgkfehkaqvilef
psredaynwyhseeyqalistrdlgmdsqfqlig

  • Chain 'Y':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3lo3Y (Y:)
snatayiivgltpkdaeklqqygarvastlakysgevlvkgsveqlhgkfehkaqvilef
psredaynwyhseeyqalistrdlgmdsqfqlig

  • Chain 'Z':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3lo3Z (Z:)
snatayiivgltpkdaeklqqygarvastlakysgevlvkgsveqlhgkfehkaqvilef
psredaynwyhseeyqalistrdlgmdsqfqlig

  • Chain 'a':
    No sequence available.

  • Chain 'b':
    No sequence available.