PDB entry 3lnu

View 3lnu on RCSB PDB site
Description: Crystal structure of ParE subunit
Class: isomerase
Keywords: topoisomeraseIV, parE, ATP-binding, Isomerase, Nucleotide-binding, Topoisomerase
Deposited on 2010-02-03, released 2011-02-16
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-02-16, with a file datestamp of 2011-02-11.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.236
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Topoisomerase IV subunit B
    Species: Xanthomonas oryzae pv. oryzae [TaxId:291331]
    Gene: parE, XOO2969
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3lnua1, d3lnua2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3lnuA (A:)
    mgsshhhhhhssglvprgshntrynaadievlsgldpvkrrpgmytdtarpnhlaqevid
    nsvdealaghakqievtlykdgscevsddgrgmpvdihpeekipgveliltrlhaggkfn
    nrnytfsgglhgvgvsvvnalstkvelfikregsehrmefrdgnaasklevvgtvgkknt
    gtrlrfwadpkyfdtpkfnvralrhllrakavlcpgltvklhdeatgeqdswyfenglrd
    ylkgemaehemlpadlfvgslkkdteivdwaagwvpegelvqesyvnliptaqhgthvng
    lrsgltdalrefcdfrnllprgvklapedvwdrvtfvlslkmtdpqfsgqtkerlssrqa
    agfiegaahdafslylnqnveigekiaqiaidrasarlktekqivrkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lnuA (A:)
    gldpvkrrpgmytdtarpnhlaqevidnsvdealaghakqievtlykdgscevsddgrgm
    pvdihpeekipgveliltrlgvsvvnalstkvelfikregsehrmefrdgnaasklevvg
    tvgkkntgtrlrfwadpkyfdtpkfnvralrhllrakavlcpgltvklhdeatgeqdswy
    fenglrdylkgemaehemlpadlfvgslkkdteivdwaagwvpegelvqesyvnliptaq
    hgthvnglrsgltdalrefcdfrnllprgvklapedvwdrvtfvlslkmtdpqfsgqtke
    rlssrqaagfiegaahdafslylnqnveigekiaqiaidrasar