PDB entry 3lnc

View 3lnc on RCSB PDB site
Description: Crystal structure of guanylate kinase from Anaplasma phagocytophilum
Class: transferase
Keywords: ALS COLLABORATIVE CRYSTALLOGRAPHY, EMERALD BIOSTRUCTURES, GUANYLATE KINASE, ATP-binding, Cytoplasm, Kinase, Nucleotide-binding, Transferase, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, SSGCID
Deposited on 2010-02-02, released 2010-02-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Guanylate kinase
    Species: Anaplasma phagocytophilum [TaxId:212042]
    Gene: gmk, APH_0170
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3lnca_
  • Chain 'B':
    Compound: Guanylate kinase
    Species: Anaplasma phagocytophilum [TaxId:212042]
    Gene: gmk, APH_0170
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2GLF7 (21-End)
      • expression tag (20)
    Domains in SCOPe 2.07: d3lncb1, d3lncb2
  • Heterogens: 5GP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3lncA (A:)
    mahhhhhhmgtleaqtqgpgsmlksvgvilvlsspsgcgkttvankllekqknnivksvs
    vttraarkgekegkdyyfvdreeflrlcsngeiiehaevfgnfygvprknlednvdkgvs
    tllvidwqgafkfmemmrehvvsifimppsmeelrrrlcgrraddsevvearlkgaafei
    shceaydyvivnedieetadrisnilraeqmktcrqvglrellesrfpied
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lncA (A:)
    mlksvgvilvlsspsgtvankllenivksvsvttraarkgekegkdyyfvdreeflrlcs
    ngeiiehaevfgnfygvprknlednvdkgvstllvidwqgafkfmemmrehvvsifimpp
    smeelrrrrlkgaafeishceaydyvivnedieetadrisnilraeqmktcrqvglrell
    esrfpied
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3lncB (B:)
    mahhhhhhmgtleaqtqgpgsmlksvgvilvlsspsgcgkttvankllekqknnivksvs
    vttraarkgekegkdyyfvdreeflrlcsngeiiehaevfgnfygvprknlednvdkgvs
    tllvidwqgafkfmemmrehvvsifimppsmeelrrrlcgrraddsevvearlkgaafei
    shceaydyvivnedieetadrisnilraeqmktcrqvglrellesrfpied
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lncB (B:)
    smlksvgvilvlsspstvankllenivksvsvttraarkgekegkdyyfvdreeflrlcs
    ngeiiehaevfgnfygvprknlednvdkgvstllvidwqgafkfmemmrehvvsifimpp
    smeelrrrarlkgaafeishceaydyvivnedieetadrisnilraeqmktcrqvglrel
    lesrfpie