PDB entry 3ln2

View 3ln2 on RCSB PDB site
Description: Crystal Structure of a Charge Engineered Human Lysozyme Variant
Class: hydrolase
Keywords: Human Lysozyme, Hydrolase, Charge Engineered human lysozyme, Protein engineering, Antimicrobial, Bacteriolytic, Surface Mutation, Amyloid, Amyloidosis, Bacteriolytic enzyme, Disease mutation, Disulfide bond, Glycosidase
Deposited on 2010-02-01, released 2011-02-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-03-23, with a file datestamp of 2011-03-18.
Experiment type: XRAY
Resolution: 2.04 Å
R-factor: 0.183
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lysozyme C
    Species: Homo sapiens [TaxId:9606]
    Gene: LYZ, LZM
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61626 (0-129)
      • engineered (100)
      • engineered (114)
    Domains in SCOPe 2.07: d3ln2a_
  • Chain 'B':
    Compound: Lysozyme C
    Species: Homo sapiens [TaxId:9606]
    Gene: LYZ, LZM
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61626 (0-129)
      • engineered (100)
      • engineered (114)
    Domains in SCOPe 2.07: d3ln2b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ln2A (A:)
    kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
    srywcndgktpgavnachlscsallqdniadavacakrvvddpqgirawvawrnhcqnrd
    vrqyvqgcgv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ln2B (B:)
    kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
    srywcndgktpgavnachlscsallqdniadavacakrvvddpqgirawvawrnhcqnrd
    vrqyvqgcgv