PDB entry 3lmy

View 3lmy on RCSB PDB site
Description: The Crystal Structure of beta-hexosaminidase B in complex with Pyrimethamine
Class: hydrolase
Keywords: 6-stranded anti-parallel beta-sheet, TIM barrel, Disease mutation, Disulfide bond, Gangliosidosis, Glycoprotein, Glycosidase, Hydrolase, Lysosome
Deposited on 2010-02-01, released 2011-02-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-02-16, with a file datestamp of 2011-02-11.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.197
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-hexosaminidase subunit beta
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3lmya1, d3lmya2
  • Chain 'B':
    Compound: Beta-hexosaminidase subunit beta
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3lmyb1, d3lmyb2
  • Heterogens: NDG, NAG, CP6, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3lmyA (A:)
    melcglglprppmllalllatllaamlalltqvalvvqvaeaarapsvsakpgpalwplp
    lsvkmtpnllhlapenfyishspnstagpsctlleeafrryhgyifgfykwhhepaefqa
    ktqvqqllvsitlqsecdafpnissdesytllvkepvavlkanrvwgalrgletfsqlvy
    qdsygtftinestiidsprfshrgilidtsrhylpvkiilktldamafnkfnvlhwhivd
    dqsfpyqsitfpelsnkgsyslshvytpndvrmvieyarlrgirvlpefdtpghtlswgk
    gqkdlltpcysrqnkldsfgpinptlnttysflttffkeisevfpdqfihlggdevefkc
    wesnpkiqdfmrqkgfgtdfkklesfyiqkvldiiatinkgsivwqevfddkaklapgti
    vevwkdsaypeelsrvtasgfpvilsapwyldlisygqdwrkyykvepldfggtqkqkql
    figgeaclwgeyvdatnltprlwprasavgerlwsskdvrdmddaydrltrhrcrmverg
    iaaqplyagycnhenm
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lmyA (A:)
    palwplplsvkmtpnllhlapenfyishspnstagpsctlleeafrryhgyiftqvqqll
    vsitlqsecdafpnissdesytllvkepvavlkanrvwgalrgletfsqlvyqdsygtft
    inestiidsprfshrgilidtsrhylpvkiilktldamafnkfnvlhwhivddqsfpyqs
    itfpelsnkgsyslshvytpndvrmvieyarlrgirvlpefdtpghtlswgkgqkdlltp
    cysdsfgpinptlnttysflttffkeisevfpdqfihlggdevefkcwesnpkiqdfmrq
    kgfgtdfkklesfyiqkvldiiatinkgsivwqevfddkaklapgtivevwkdsaypeel
    srvtasgfpvilsapwyldlisygqdwrkyykvepldfggtqkqkqlfiggeaclwgeyv
    datnltprlwprasavgerlwsskdvrdmddaydrltrhrcrmvergiaaqplyagycn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3lmyB (B:)
    melcglglprppmllalllatllaamlalltqvalvvqvaeaarapsvsakpgpalwplp
    lsvkmtpnllhlapenfyishspnstagpsctlleeafrryhgyifgfykwhhepaefqa
    ktqvqqllvsitlqsecdafpnissdesytllvkepvavlkanrvwgalrgletfsqlvy
    qdsygtftinestiidsprfshrgilidtsrhylpvkiilktldamafnkfnvlhwhivd
    dqsfpyqsitfpelsnkgsyslshvytpndvrmvieyarlrgirvlpefdtpghtlswgk
    gqkdlltpcysrqnkldsfgpinptlnttysflttffkeisevfpdqfihlggdevefkc
    wesnpkiqdfmrqkgfgtdfkklesfyiqkvldiiatinkgsivwqevfddkaklapgti
    vevwkdsaypeelsrvtasgfpvilsapwyldlisygqdwrkyykvepldfggtqkqkql
    figgeaclwgeyvdatnltprlwprasavgerlwsskdvrdmddaydrltrhrcrmverg
    iaaqplyagycnhenm
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lmyB (B:)
    palwplplsvkmtpnllhlapenfyishspnstagpsctlleeafrryhgyifgtqvqql
    lvsitlqsecdafpnissdesytllvkepvavlkanrvwgalrgletfsqlvyqdsygtf
    tinestiidsprfshrgilidtsrhylpvkiilktldamafnkfnvlhwhivddqsfpyq
    sitfpelsnkgsyslshvytpndvrmvieyarlrgirvlpefdtpghtlswgkgqkdllt
    pcysdsfgpinptlnttysflttffkeisevfpdqfihlggdevefkcwesnpkiqdfmr
    qkgfgtdfkklesfyiqkvldiiatinkgsivwqevfddkaklapgtivevwkdsaypee
    lsrvtasgfpvilsapwyldlisygqdwrkyykvepldfggtqkqkqlfiggeaclwgey
    vdatnltprlwprasavgerlwsskdvrdmddaydrltrhrcrmvergiaaqplyagycn