PDB entry 3lms

View 3lms on RCSB PDB site
Description: Structure of human activated thrombin-activatable fibrinolysis inhibitor, TAFIa, in complex with tick-derived funnelin inhibitor, TCI.
Class: hydrolase/hydrolase inhibitor
Keywords: fibrinolysis, cogaulation, funnelin, alpha-beta-hydrolase, metallopeptidase, Alternative splicing, Carboxypeptidase, Disulfide bond, Glycoprotein, Hydrolase, Metal-binding, Metalloprotease, Polymorphism, Protease, Secreted, Zinc, Zymogen, Blood coagulation, Metalloenzyme inhibitor, Metalloprotease inhibitor, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2010-02-01, released 2010-02-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Carboxypeptidase B2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3lmsa_
  • Chain 'B':
    Compound: carboxypeptidase inhibitor
    Species: Rhipicephalus bursa [TaxId:67831]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3lmsb1, d3lmsb2
  • Heterogens: ZN, GLY, GOL, CL, CA, K, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3lmsA (A:)
    asasyyeqyhslneiyswiefiterhpdmltkihigssfekyplyvlkvsgkeqaaknai
    widcgiharewispafclwfighitqfygiigqytnllrlvdfyvmpvvnvdgydyswkk
    nrmwrknrsfyannhcigtdlnrnfaskhwceegasssscsetycglypesepevkavas
    flrrninqikayismhsysqhivfpysytrskskdheelslvaseavraiektskntryt
    hghgsetlylapgggddwiydlgikysftielrdtgtygfllperyikptcreafaavsk
    iawhvirnv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3lmsB (B:)
    necvskgfgclpqsdcpqearlsyggcstvccdlskltgckgkggecnpldrqckelqae
    sascgkgqkccvwl