PDB entry 3lmk

View 3lmk on RCSB PDB site
Description: Ligand Binding Domain of Metabotropoc glutamate receptor mGluR5 complexed with glutamate
Class: signaling protein
Keywords: GLUTAMATE RECEPTORS, MGLUR1, DIMERIZATION, GLUTAMIC ACID, Cell membrane, G-protein coupled receptor, Glycoprotein, Membrane, Receptor, Transducer, Transmembrane, Structural Genomics, Structural Genomics Consortium, SGC, SIGNALING PROTEIN
Deposited on 2010-01-30, released 2010-02-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.44 Å
R-factor: 0.234
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Metabotropic glutamate receptor 5
    Species: Homo sapiens [TaxId:9606]
    Gene: GPRC1E, GRM5, MGLUR5
    Database cross-references and differences (RAF-indexed):
    • Uniprot P41594
      • engineered (227)
    Domains in SCOPe 2.06: d3lmka_
  • Chain 'B':
    Compound: Metabotropic glutamate receptor 5
    Species: Homo sapiens [TaxId:9606]
    Gene: GPRC1E, GRM5, MGLUR5
    Database cross-references and differences (RAF-indexed):
    • Uniprot P41594
      • engineered (227)
    Domains in SCOPe 2.06: d3lmkb_
  • Heterogens: NAG, GLU, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3lmkA (A:)
    gamdgsaqsserrvvahmpgdiiigalfsvhhqptvdkvherkcgavreqygiqrveaml
    htlerinsdptllpnitlgceirdscwhsavaleqsiefirdslisseeeeglvrcvdgs
    sssfrskkpivgvigpgsssvaiqvqnllqlfnipqiaysatsmdlsdktlfkyfmrvvp
    sdaqqaramvdivkrynwtyvsavhtegnygesgmeafkdmsakegisiahsykiysnag
    eqsfdkllkkltshlpkarvvacfcegmtvrgllmamrrlglageflllgsdgwadrydv
    tdgyqreavggitiklqspdvkwfddyylklrpetnhrnpwfqefwqhrfqcrlegfpqe
    nskynktcnssltlkthhvqdskmgfvinaiysmayglhnmqmslcpgyaglcdamkpid
    grklleslmktnftgvsgdtilfdengdspgryeimnfkemgkdyfdyinvgswdngelk
    mdddevwskksn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lmkA (A:)
    rrvvahmpgdiiigalfsvhhqptvdkvherkcgavreqygiqrveamlhtlerinsdpt
    llpnitlgceirdscwhsavaleqsiefirdkpivgvigpgsssvaiqvqnllqlfnipq
    iaysatsmdlsdktlfkyfmrvvpsdaqqaramvdivkrynwtyvsavhtegnygesgme
    afkdmsakegisiahsykiysnageqsfdkllkkltshlpkarvvacfcegmtvrgllma
    mrrlglageflllgsdgwadrydvtdgyqreavggitiklqspdvkwfddyylklrpetn
    hrnpwfqefwqhrfqcrlegnktcnssltlkthhvqdskmgfvinaiysmayglhnmqms
    lcpgyaglcdamkpidgrklleslmktnftgvsgdtilfdengdspgryeimnfkemgkd
    yfdyinvgswdngelkmd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3lmkB (B:)
    gamdgsaqsserrvvahmpgdiiigalfsvhhqptvdkvherkcgavreqygiqrveaml
    htlerinsdptllpnitlgceirdscwhsavaleqsiefirdslisseeeeglvrcvdgs
    sssfrskkpivgvigpgsssvaiqvqnllqlfnipqiaysatsmdlsdktlfkyfmrvvp
    sdaqqaramvdivkrynwtyvsavhtegnygesgmeafkdmsakegisiahsykiysnag
    eqsfdkllkkltshlpkarvvacfcegmtvrgllmamrrlglageflllgsdgwadrydv
    tdgyqreavggitiklqspdvkwfddyylklrpetnhrnpwfqefwqhrfqcrlegfpqe
    nskynktcnssltlkthhvqdskmgfvinaiysmayglhnmqmslcpgyaglcdamkpid
    grklleslmktnftgvsgdtilfdengdspgryeimnfkemgkdyfdyinvgswdngelk
    mdddevwskksn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lmkB (B:)
    rvvahmpgdiiigalfsvhhqptvdkvherkcgavreqygiqrveamlhtlerinsdptl
    lpnitlgceirdscwhsavaleqsiefirdkpivgvigpgsssvaiqvqnllqlfnipqi
    aysatsmdlsdktlfkyfmrvvpsdaqqaramvdivkrynwtyvsavhtegnygesgmea
    fkdmsakegisiahsykiysnageqsfdkllkkltshlpkarvvacfcegmtvrgllmam
    rrlglageflllgsdgwadrydvtdgyqreavggitiklqspdvkwfddyylklrpetnh
    rnpwfqefwqhrfqcrlegkynktcnssltlkthhvqdskmgfvinaiysmayglhnmqm
    slcpgyaglcdamkpidgrklleslmktnftgvsgdtilfdengdspgryeimnfkemgk
    dyfdyinvgswdngelkmd