PDB entry 3ljt

View 3ljt on RCSB PDB site
Description: Crystal Structure of the Catalytic Domain of ADAMTS-5 in Complex with an Amino-2-indanol compound
Class: hydrolase
Keywords: alpha/beta structure, central five stranded beta-sheet, Cleavage on pair of basic residues, Disulfide bond, Extracellular matrix, Glycoprotein, Metal-binding, Metalloprotease, Protease, Secreted, Zymogen, HYDROLASE
Deposited on 2010-01-26, released 2010-03-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: A disintegrin and metalloproteinase with thrombospondin motifs 5
    Species: Homo sapiens [TaxId:9606]
    Gene: ADAMTS-5, ADAMTS11, ADAMTS5, ADMP2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UNA0 (1-217)
      • expression tag (0)
      • engineered (19)
    Domains in SCOPe 2.07: d3ljta1, d3ljta2
  • Heterogens: LA3, EDO, ZN, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ljtA (A:)
    asrarqvelllvadasmarkygrglqhylltlasianrlyshasienhirlavvkvvvlg
    dkdkslevsknaattlknfckwqhqhnqlgddheehydaailftredlcghhscdtlgma
    dvgticsperscavieddglhaaftvaheighllglshddskfceetfgstedkrlmssi
    ltsidaskpwskctsatiteflddghgnclldlprkqi