PDB entry 3ljr

View 3ljr on RCSB PDB site
Description:
Deposited on 1998-03-08, released 1999-03-23
The last revision prior to the SCOP 1.69 freeze date was dated 1999-03-23, with a file datestamp of 1999-03-23.
Experiment type: XRAY
Resolution: 3.3 Å
R-factor: 0.238
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.69: d3ljra1, d3ljra2
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.69: d3ljrb1, d3ljrb2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ljrA (A:)
    mglelfldlvsqpsravyifakkngiplelrtvdlvkgqhkskeflqinslgklptlkdg
    dfiltessailiylsckyqtpdhwypsdlqararvheylgwhadcirgtfgiplwvqvlg
    pligvqvpeekvernrtamdqalqwledkflgdrpflagqqvtladlmaleelmqpvalg
    yelfegrprlaawrgrveaflgaelcqeahsiilsileqaakktlptpspeayqamllri
    arip
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ljrB (B:)
    mglelfldlvsqpsravyifakkngiplelrtvdlvkgqhkskeflqinslgklptlkdg
    dfiltessailiylsckyqtpdhwypsdlqararvheylgwhadcirgtfgiplwvqvlg
    pligvqvpeekvernrtamdqalqwledkflgdrpflagqqvtladlmaleelmqpvalg
    yelfegrprlaawrgrveaflgaelcqeahsiilsileqaakktlptpspeayqamllri
    arip