PDB entry 3lji

View 3lji on RCSB PDB site
Description: CRYSTAL STRUCTURE OF putative geranyltranstransferase from Pseudomonas fluorescens Pf-5
Class: transferase
Keywords: STRUCTURAL GENOMICS, PROTEIN STRUCTURE INITIATIVE, NEW YORK STRUCTURAL GENOMIX RESEARCH CONSORTIUM, NYSGXRC, Isoprene biosynthesis, PSI-2, New York SGX Research Center for Structural Genomics, TRANSFERASE
Deposited on 2010-01-26, released 2010-02-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 1.39 Å
R-factor: N/A
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Geranyltranstransferase
    Species: Pseudomonas fluorescens [TaxId:220664]
    Gene: PFL_5509
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q4K5A6 (3-End)
      • expression tag (1-2)
    Domains in SCOPe 2.07: d3ljia1, d3ljia2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ljiA (A:)
    msltayqassqarvdaamhtlftapspelarlyeamrysvmnggkrvrpllayaacealg
    gkpeqangaacavelihayslvhddlpamddddlrrgqptthkafdeacailagdglqsl
    afsalldpalsdasaeirlrmvttlaqaagpagmvggqaidlgsvglkldqqaleymhrh
    ktgalieasvilgalasgraekgelkalqtyaqaiglafqvqddildvesdtatlgkrqg
    adiardkptypallglaaakeyalelrdqalhalrpfdaaaeplrelaryiverrseghh
    hhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ljiA (A:)
    sltayqassqarvdaamhtlftapspelarlyeamrysvmnggkrvrpllayaacealgg
    kpeqangaacavelihayslvhddlpamddddlrrgqptthkafdeacailagdglqsla
    fsalldpalsdasaeirlrmvttlaqaagpagmvggqaidlgsvglkldqqaleymhrhk
    tgalieasvilgalasgraekgelkalqtyaqaiglafqvqddildptypallglaaake
    yalelrdqalhalrpfdaaaeplrelaryive