PDB entry 3ljf

View 3ljf on RCSB PDB site
Description: The X-ray structure of iron superoxide dismutase from Pseudoalteromonas haloplanktis (crystal form II)
Class: oxidoreductase
Keywords: cold adaptation, superoxide dismutase, flexibility, thermal stability, psychrophilic protein, Metal-binding, Oxidoreductase
Deposited on 2010-01-26, released 2010-09-08
The last revision prior to the SCOPe 2.04 freeze date was dated 2010-11-24, with a file datestamp of 2010-11-19.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.192
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: iron superoxide dismutase
    Species: Pseudoalteromonas haloplanktis [TaxId:326442]
    Gene: sodB, PSHAa1215
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3ljfa1, d3ljfa2
  • Chain 'B':
    Compound: iron superoxide dismutase
    Species: Pseudoalteromonas haloplanktis [TaxId:326442]
    Gene: sodB, PSHAa1215
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3ljfb1, d3ljfb2
  • Chain 'C':
    Compound: iron superoxide dismutase
    Species: Pseudoalteromonas haloplanktis [TaxId:326442]
    Gene: sodB, PSHAa1215
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3ljfc1, d3ljfc2
  • Chain 'D':
    Compound: iron superoxide dismutase
    Species: Pseudoalteromonas haloplanktis [TaxId:326442]
    Gene: sodB, PSHAa1215
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3ljfd1, d3ljfd2
  • Heterogens: FE, TRE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ljfA (A:)
    afelpslpyaidalephisketlefhhgkhhntyvvklnglipgtkfenksleeivcssd
    ggvfnnaaqiwnhtfywnslspngggaptgavadainakwgsfdafkealndkavnnfgs
    swtwlvkladgsldivntsnaatpltddgvtpiltvdlwehayyidyrnvrpdylkgfws
    lvnwefananfa
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ljfB (B:)
    afelpslpyaidalephisketlefhhgkhhntyvvklnglipgtkfenksleeivcssd
    ggvfnnaaqiwnhtfywnslspngggaptgavadainakwgsfdafkealndkavnnfgs
    swtwlvkladgsldivntsnaatpltddgvtpiltvdlwehayyidyrnvrpdylkgfws
    lvnwefananfa
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ljfC (C:)
    afelpslpyaidalephisketlefhhgkhhntyvvklnglipgtkfenksleeivcssd
    ggvfnnaaqiwnhtfywnslspngggaptgavadainakwgsfdafkealndkavnnfgs
    swtwlvkladgsldivntsnaatpltddgvtpiltvdlwehayyidyrnvrpdylkgfws
    lvnwefananfa
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ljfD (D:)
    afelpslpyaidalephisketlefhhgkhhntyvvklnglipgtkfenksleeivcssd
    ggvfnnaaqiwnhtfywnslspngggaptgavadainakwgsfdafkealndkavnnfgs
    swtwlvkladgsldivntsnaatpltddgvtpiltvdlwehayyidyrnvrpdylkgfws
    lvnwefananfa