PDB entry 3lio

View 3lio on RCSB PDB site
Description: X-ray structure of the iron superoxide dismutase from pseudoalteromonas haloplanktis (crystal form I)
Class: oxidoreductase
Keywords: cold adaptation, superoxide dismutase, flexibility, thermal stability, psychrophilic protein, Metal-binding, Oxidoreductase
Deposited on 2010-01-25, released 2010-09-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-11-24, with a file datestamp of 2010-11-19.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.185
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: iron superoxide dismutase
    Species: Pseudoalteromonas haloplanktis [TaxId:326442]
    Gene: PSHAa1215, sodB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3lioa1, d3lioa2
  • Chain 'B':
    Compound: iron superoxide dismutase
    Species: Pseudoalteromonas haloplanktis [TaxId:326442]
    Gene: PSHAa1215, sodB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3liob1, d3liob2
  • Heterogens: TRE, FE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3lioA (A:)
    afelpslpyaidalephisketlefhhgkhhntyvvklnglipgtkfenksleeivcssd
    ggvfnnaaqiwnhtfywnslspngggaptgavadainakwgsfdafkealndkavnnfgs
    swtwlvkladgsldivntsnaatpltddgvtpiltvdlwehayyidyrnvrpdylkgfws
    lvnwefananfa
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3lioB (B:)
    afelpslpyaidalephisketlefhhgkhhntyvvklnglipgtkfenksleeivcssd
    ggvfnnaaqiwnhtfywnslspngggaptgavadainakwgsfdafkealndkavnnfgs
    swtwlvkladgsldivntsnaatpltddgvtpiltvdlwehayyidyrnvrpdylkgfws
    lvnwefananfa