PDB entry 3lik

View 3lik on RCSB PDB site
Description: Human MMP12 in complex with non-zinc chelating inhibitor
Class: hydrolase/hydrolase inhibitor
Keywords: MMP12 elastase non-chelating inhibitor, HYDROLASE, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2010-01-25, released 2010-09-01
The last revision prior to the SCOPe 2.05 freeze date was dated 2010-12-08, with a file datestamp of 2010-12-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.16
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Macrophage metalloelastase
    Species: Homo sapiens [TaxId:9606]
    Gene: MMP12, HME
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39900 (1-158)
      • expression tag (0)
      • engineered mutation (66)
    Domains in SCOPe 2.05: d3lika_
  • Heterogens: ZN, CA, EEG, HAE, P6G, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3likA (A:)
    mgpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfa
    rgahgddhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighsl
    glghssdpkavmfptykyvdintfrlsaddirgiqslyg